Primary information |
---|
ID | 1182 |
Peptide Name | SMRV-H peptide |
Sequence | EVVLQNRRGLDLLTAEQGGICLALQERCCFYANKS |
Length | 35 |
Chirality | D |
N-terminal Modification | None |
C-terminal Modification | None |
Chemical Modification | None |
Linear/ Cyclic | Linear |
Nature | Protein Derived |
Source of Origin | Squirrel monkey retrovirus (SMRV) |
Target | NA |
Mechanism of Action | Not Available |
In vitro/In vivo | In vitro |
Cell Line | U937, P2, JLS-V5 |
Inhibition Concentartion | NA |
In vivo Model | NA |
Assay | NA |
Lethal Dose | NA |
Combination Therapy | NA |
Pubmed ID | 3201749 |
Year of Publication | 1988 |
3-D Structure | View in Jmol or Download Structure |