| 1217 | SEQ ID NO: 6 | QMNLILAKFLHWLCMTWNQMNLILAKFLHWLCMTW | 35 | L | None | None | None | Linear | Protein Derived | human telomerase reverse transcriptase | Proteasome | Inhibits the overall activity of the proteasome | In vitro | HeLa, Saos | NA | NA | NA | NA | NA | DE 102006025146 A1 | 2007 |
| 1218 | SEQ ID NO: 7 | RLMYILAKFLHWLGPSRLMYILAKFLHWLGPS | 32 | L | None | None | None | Linear | Protein Derived | human telomerase reverse transcriptase | Proteasome | Inhibits the overall activity of the proteasome | In vitro | HeLa, Saos | NA | NA | NA | NA | NA | DE 102006025146 A1 | 2007 |
| 1219 | SEQ ID NO: 8 | VHNVILAKFLHWLSTAPPVHNVILAKFLHWLSTAPPV | 37 | L | None | None | None | Linear | Protein Derived | human telomerase reverse transcriptase | Proteasome | Inhibits the overall activity of the proteasome | In vitro | HeLa, Saos | NA | NA | NA | NA | NA | DE 102006025146 A1 | 2007 |
| 1220 | NA | CVRGLYIDFRKDLGWK | 16 | L | None | None | None | Linear | Synthetic | Retro virus | Lymphocytes, TGF | Inhibits cell proliferation, conjugated polypeptide block the binding of TGF-B to its receptor | Both | Mu-I-Lv | NA | DBA/IJ male mice | Thymidine incorporation assay, TGF-fi Radioreceptor Binding Assay, Mice arthritis model | NA | Coupled to carrier proteins or crosslinked to form polymers | CA2057896C | 2000 |
| 1221 | Aalpha (SEQ ID NO 12) | ERHQSACKDSDWPFCSDEDWNYK | 23 | L | None | None | None | Linear | Protein Derived | Alpha chain of the fibrin | Lymphocyte | Suppress increase in inflammatory cells, Aalpha Gly Pro Arg (Pro) - NH 2 acetate (Aalpha derivative) short peptide is equally effective as the long peptides in appropriate continuous addition at inhibiting monocyte migration | In vivo | PBMC | NA | HU-SCID mouse model | NA | NA | NA | WO 2002048180 A2 | 2002 |
| 1222 | Bbeta (SEQ ID NO 11) | DKRKEEAPSLRPAPPPISGGGYR | 23 | L | None | None | None | Linear | Protein Derived | Beta chain of the fibrin | Lymphocyte | Inhibition of Lymphocyte migration, blocks the lymphocytic inflammation, Bbeta Gly His Arg Pro-OH acetate (Bbeta derivative) short peptide is equally effective as the long peptides in appropriate continuous addition at inhibiting monocyte migration | In vivo | PBMC | NA | HU-SCID mouse model | NA | NA | NA | WO 2002048180 A2 | 2002 |
| 1223 | sequence no 4 | HFKRPLPPLPSL | 12 | L | None | None | None | Linear | Synthetic | NA | T-cell, Hematopoietic cell | Human T-cell tyrosine kinase (Lck) inhibitor, Hematopoietic cell kinase (Hck) inhibitor | In vitro | NA | NA | NA | Lck-SH3 binding assay, NMR Spectroscopy, protein-protein interactions assay by PepSpot membranes | NA | NA | EP 1983050 A1 | 2008 |
| 1224 | SEQ ID NO:60 | LVCYYTSWS | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1225 | SEQ ID NO:61 | FLCTHIIYS | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1226 | SEQ ID NO:62 | IIYSFANIS | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1227 | SEQ ID NO:63 | LKTLLSVGG | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1228 | SEQ ID NO:64 | FIKSVPPFL | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1229 | SEQ ID NO:65 | FDGLDLAWL | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1230 | SEQ ID NO:66 | LYPGRRDKQ | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1231 | SEQ ID NO:67 | YDIAKISQH | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1232 | SEQ ID NO:68 | LDFISIMTY | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1233 | SEQ ID NO:69 | FISIMTYDF | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1234 | SEQ ID NO:70 | FRGQEDASP | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1235 | SEQ ID NO:71 | YAVGYMLRL | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1236 | SEQ ID NO:72 | MLRLGAPAS | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1237 | SEQ ID NO:73 | LAYYEICDF | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1238 | SEQ ID NO:74 | LRGATVHRT | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1239 | SEQ ID NO:75 | YLKDRQLAG | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1240 | SEQ ID NO:76 | LAGAMVWAL | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1241 | SEQ ID NO:77 | VWALDLDDF | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1242 | SEQ ID NO:78 | LDLDDFQGS | 9 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1243 | SEQ ID NO:l | YKLVCYYTSWSQYREG | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1244 | SEQ ID NO:2 | YTSWSQYREGDGSCFP | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1245 | SEQ ID NO:5 | LDRFLCTHIIYSFANI | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1246 | SEQ ID NO:6 | THIIYSFANISNDHID | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1247 | SEQ ID NO:12 | PNLKTLLSVGGWNFGS | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1248 | SEQ ID NO:16 | NTQSRRTFIKSVPPFL | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1249 | SEQ ID NO:17 | TFIKSVPPFLRTHGFD | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1250 | SEQ ID NO:18 | PPFLRTHGFDGLDLAW | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1251 | SEQ ID NO:19 | HGFDGLDLAWLYPGRR | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1252 | SEQ ID NO:20 | DLAWLYPGRRDKQHFT | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1253 | SEQ ID NO:28 | IDSSYDIAKISQHLD | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1254 | SEQ ID NO:29 | DIAKISQHLDFISIMT | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1255 | SEQ ID NO:30 | QHLDFISIMTYDFHGA | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1256 | SEQ ID NO:34 | SPLFRGQEDASPDRFS | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1257 | SEQ ID NO:37 | DYAVGYMLRLGAPASK | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1258 | SEQ ID NO:38 | MLRLGAPASKLVMGIP | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1259 | SEQ ID NO:39 | PASKLVMGIPTFGRSF | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1260 | SEQ ID NO:46 | GTLAYYEICDFLRGAT | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1261 | SEQ ID NO:47 | EICDFLRGATVHRTLG | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1262 | SEQ ID NO:48 | RGATVHRTLGQQVPYA | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1263 | SEQ ID NO:53 | VKSKVQYLKDRQLAGA | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1264 | SEQ ID NO:54 | YLKDRQLAGAMVWALD | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1265 | SEQ ID NO:55 | LAGAMVWALDLDDFQG | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
| 1266 | SEQ ID NO:56 | WALDLDDFQGSFCGQD | 16 | L | None | None | None | Linear | Protein Derived | Human Cartilage glycoprotein 39 | T-cells | Induce systemic immunological tolerance to the autoantigens under attack of the autoreactive T-cells, specific effect on the autoreactive T cells thus leaving the other components of the immune system intact | In vitro | PBMC | NA | NA | Peptide HLA-DR binding assay and Proliferative responses of blood mononuclear cells by thymidine incorporation assay | NA | NA | WO 1997040068 A1 | 1997 |
