| Primary information |
|---|
| ID | 1217 |
| Peptide Name | SEQ ID NO: 6 |
| Sequence | QMNLILAKFLHWLCMTWNQMNLILAKFLHWLCMTW |
| Length | 35 |
| Chirality | L |
| N-terminal Modification | None |
| C-terminal Modification | None |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Nature | Protein Derived |
| Source of Origin | human telomerase reverse transcriptase |
| Target | Proteasome |
| Mechanism of Action | Inhibits the overall activity of the proteasome |
| In vitro/In vivo | In vitro |
| Cell Line | HeLa, Saos |
| Inhibition Concentartion | NA |
| In vivo Model | NA |
| Assay | NA |
| Lethal Dose | NA |
| Combination Therapy | NA |
| Pubmed ID | DE 102006025146 A1 |
| Year of Publication | 2007 |
| 3-D Structure |  View in Jmol or Download Structure |
