Browse result page of CPPsite 2.0
The total number entries retrieved from this search are 774| ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 2312 | RQIKIWFQNRRMKWKK | Penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Peptide (Mitochondrial Target Domain of NOXA) | 24416126 |
| 2314 | RIMRILRILKLAR | DS4.3 | 13 | L | Linear | Protein derived | NA | Free | Free | NA | Peptide (Mitochondrial Target Domain of NOXA) | 24416126 |
| 2317 | YGRKKRRQRRR | TAT(47-57) | 11 | L | Linear | Protein derived | Cationic | Biotinylation | Amidation | NA | Biotin-gly4 | 25112713 |
| 2319 | RQIKIWFQNRRMKWKK | Penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | Biotinylation | Amidation | NA | Biotin-gly4 | 25112713 |
| 2321 | RKKRRQRRRGGG | Tat | 12 | L | Linear | Protein derived | Cationic | Free | Amidation | NA | Fluorophore (TAMRA) | 24218116 |
| 2323 | RQIKIWFQNRRMKWKK | Penetratin (Antennapedia) | 16 | L | Linear | Protein derived | Cationic | Free | Free | NA | Protein (ATTO488-BSA, ?-galactosidase) | 24275947 |
| 2324 | YGRKKRRQRRR | HIV-TAT (47-57) | 11 | L | Linear | Protein derived | Cationic | Free | Amidation | NA | Protein (ATTO488-BSA, ?-galactosidase) | 24275947 |
| 2330 | YGRKKRRQRRRC | Tat-C-Cy5 | 12 | L | Linear | Protein derived | Cationic | Free | Cysteine addition | NA | Fluorophore (Cy5) | 24276021 |
| 2331 | RQIKIWFQNRRMKWKKC | Pen-C-Cy5 | 17 | L | Linear | Protein derived | Cationic and amphipathic | Free | Cysteine addition | NA | Fluorophore (Cy5) | 24276021 |
| 2341 | GRKKRRQRRRPPQK | TAT | 14 | L | Linear | Protein derived | Cationic | Conjugation with 5-carboxyfluorescein via a lysine residue | Free | NA | Fluorophore [5-carboxyfluorescein (FAM)] | 24521351 |
| 2342 | RQIKIWFQNRRMKWKKK | Penetratin | 17 | L | Linear | Protein derived | Cationic and amphipathic | Conjugation with 5-carboxyfluorescein via a lysine residue | Free | NA | Fluorophore [5-carboxyfluorescein (FAM)] | 24521351 |
| 2347 | YGRKKRRQRRR | TAT-ELPBC | 11 | L | Linear | Protein derived | Cationic | Conjugation with ELPBC | Free | NA | Peptide (BH3 peptide drug and ELPBC) | 24611762 |
| 2412 | YGRKKRRQRRRGC | TAT | 13 | L | Linear | Protein derived | Cationic | Free | Amidation | NA | NA | 24867193 |
| 2413 | YGRKKRRQRRR | Tat | 11 | L | Linear | Protein derived | Cationic | Free | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein] | 24870379 |
| 2428 | LLIILRRRIRKQAHAHSK | pVEC | 18 | L | Linear | Protein derived | Amphipathic | Free | Amidation | NA | Fluorophore [5(6)-carboxyfluorescein] | 24870379 |
| 2436 | VTPHHVLVDEYTGEWVDSQFK | VG-21 | 21 | L | Linear | Protein derived | NA | Free | Free | NA | Fluorophore (FITC) | 25154664 |
| 2441 | YGRKKRRQRRR | PNIPAM-FL-TAT Peptide | 11 | L | Linear | Protein derived | Cationic | Conjugated with PNIPAM-FL molecule | Free | NA | Nanoparticle [poly(N-isopropylacrylamide) (PNIPAM) microgel particles] | 25170605 |
| 2450 | RQIKIWFQNRRMKWKK | Penetratin | 16 | L | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Insulin) | 24973720 |
| 2451 | rqikiwfqnrrmkwkk | Penetratin | 16 | D | Linear | Protein derived | Cationic and amphipathic | Free | Free | NA | Protein (Insulin) | 24973720 |
| 2468 | YGRKKRRQRRRPPQG | TAT | 15 | L | Linear | Protein derived | Cationic | Conjugation with Alexa Flour 488 | Free | NA | Fluorophore (Alexa Fluor 488) | 24985034 |
| 2470 | VSRRRRRRGGRRRR | C24-LMWP | 14 | L | Linear | Protein derived | Cationic | Free | Free | NA | Nanoparticle (LMWP/PLGA nanoparticles), Small molecule drug (Doxorubicin) | 25003794 |
| 2471 | HSDAVFTDNYTALRKQMAVKKYLNSILNYGRKKRRQRRR | VIP-TAT | 39 | L | Linear | Protein derived | Cationic | Conjugated with VIP | Free | NA | Fluorophore (FITC) | 25086267 |
| 2475 | GRKKRRQRRR | Cys(BSH)-TAT | 10 | L | Linear | Protein derived | Cationic | Addition of cysteine and BSH | NA | NA | BSH | 24452095 |
| 2477 | CGRKKRRQRRRPPQ | NTD | 14 | L | Linear | Protein derived | Cationic | Acetylation | Amidation | Doxorubicin is attached by a cathepsin B degradable tetrapeptide linker (-Gly-Phe-Leu-Gly-). | Small molecule drug (Doxorubicin) | 24892976 |
| 2478 | KGRKKRRQRRRPPQ | d-NTD | 14 | L | Linear | Protein derived | Cationic | Acetylation | Amidation | Doxorubicin is attached by a cathepsin B degradable tetrapeptide linker (-Gly-Phe-Leu-Gly-). | Small molecule drug (Doxorubicin) | 24892976 |
| 2479 | KGRKKRRQRRRPPQ | q-NTD | 14 | L | Linear | Protein derived | Cationic | Acetylation | Amidation | Doxorubicin is attached by a cathepsin B degradable tetrapeptide linker (-Gly-Phe-Leu-Gly-). | Small molecule drug (Doxorubicin) | 24892976 |
| 2480 | CGRKKRRQRRRPPQ | n-NTD | 14 | L | Linear | Protein derived | Cationic | Acetylation | Amidation | Doxorubicin is attached by a cathepsin B degradable tetrapeptide linker (-Gly-Phe-Leu-Gly-). | Small molecule drug (Doxorubicin) | 24892976 |
| 2481 | CGRKKRRQRRRPPQ | C16NTD | 14 | L | Linear | Protein derived | Cationic | Palmitoylation | Amidation | Doxorubicin is attached by a cathepsin B degradable tetrapeptide linker (-Gly-Phe-Leu-Gly-). | Small molecule drug (Doxorubicin) | 24892976 |
| 2491 | CGYGRKKRRQRRRGC | Tat | 15 | L | Linear | Protein derived | Cationic | Free | Free | NA | Ultrasound contrast agent (UCA), Fluorophore (FITC) | 24985759 |
| 2494 | GRKKRRQRRRPPQ | pTat | 13 | L | Linear | Protein derived | Cationic | Conjugation with fluorescein | Amidation | NA | Fluorophore (Fluorescein) | 25016968 |
| 2495 | RQIKIWFQNRRMKWKK | pAntp | 16 | L | Linear | Protein derived | Cationic and amphipathic | Conjugation with fluorescein | Amidation | NA | Fluorophore (Fluorescein) | 25016968 |
| 2503 | YGRKKRRQRRR | TAT-BID | 11 | L | Linear | Protein derived | Cationic | Conjugation with 6-histidine tag | Conjugation with BID-3xHA | NA | Protein (BID) | 25326334 |
| 2504 | YGRKKRRQRRR | TAT-lyophiliosomes | 11 | L | Linear | Protein derived | Cationic | Conjugated with lyophilisome via cysteine linker | Free | NA | Nanoparticle (Lyophiliosomes and FITC labelled) | 25369131 |
| 2506 | YGRKKRRQRRR | Tat | 11 | Modified | Linear | Protein derived | Cationic | Free | Conjugation with Avidin-FITC | Biotinylation | Protein (Avidin-FITC) | 25387797 |
| 2514 | RKKRRQRRRRKKRRQRRR | Tat2-Nat | 18 | L | Linear | Protein derived | Cationic | Conjugation with FITC | Conjugation with natamycin | NA | Small molecule drug (Natamycin), Fluorophore (FITC) | 25467959 |
| 2517 | CAYGRKKRRQRRR | TAT-LP-PTX | 13 | L | Linear | Protein derived | Cationic | Cysteine addition | Conjugation with rhodamine LP | NA | Nanoparticle (Liposome) | 25482610 |
| 2518 | CAYGRKKRRQRRR | T7/TAT-LP-PTX | 13 | L | Linear | Protein derived | Cationic | Conjugated with T7 | Conjugation with rhodamine LP | NA | Nanoparticle (Liposome) | 25482610 |
| 2525 | KWCFRVCYRGICYRRCRGK | Tpl | 19 | L | Linear | Protein derived | NA | Biotinylation | Free | NA | Protein (?-glucuronidase enzyme, ?-galactosidase) | 25514997 |
| 2542 | CTSTTAKRKKRKLK | LI | 14 | L | Linear | Protein derived | NA | Addition of cysteine | Free | NA | Nucleic acid (Plasmid DNA and siRNA) | 23769994 |
| 2543 | YGRKKRRQRRR | CF-TAT-substrate | 11 | L | Linear | Protein derived | NA | Conjugation with 5(6)-carboxyfluorescein N-hydroxysuccinimidyl ester | Conjugation with substrate | NA | Fluorophore (Fluorescein), substrate | 23621550 |
| 2544 | YGRKKRRQRRR | Ac-TAT-substrate | 11 | L | Linear | Protein derived | NA | Acetylation | Conjugation with substrate | NA | Fluorophore (Fluorescein), substrate | 23621550 |
| 2545 | KKWKMRRNQFWIKIQR | CF-Penetratin-substrate | 16 | L | Linear | Protein derived | Cationic and amphipathic | Conjugation with 5(6)-Carboxyfluorescein | Conjugation with substrate | NA | Fluorophore (Fluorescein), substrate | 23621550 |
| 2546 | KKWKMRRNQFWIKIQR | Ac-Penetratin-substrate | 16 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Conjugation with substrate | NA | Fluorophore (Fluorescein), substrate | 23621550 |
| 2548 | RQIKIWFQNRRMKWKKGG | CS-Lin-Pen | 18 | L | Linear | Protein derived | Cationic | Conjugated to CS-Lin | Free | NA | Nanoparticles (FITC labeled CS-Lin) | 24083483 |
| 2549 | MRRIRPRPPRLPRPRPRPLPFPRPGGCYPG | Bac-ELP-H1 | 30 | L | Linear | Protein derived | Cationic | Free | Conjugation with ELP-Rho | NA | Peptide (Rhodamine labeled ELP) | 23372821 |
| 2550 | RGGRLSYSRRRFSTSTGRA | SynB1-ELP-H1 | 19 | L | Linear | Protein derived | Amphipathic | Free | Conjugation with ELP-Rho | NA | Peptide (Rhodamine labeled ELP) | 23372821 |
| 2551 | YGRKKRRQRRR | ST1-104 | 11 | L | Linear | Protein derived | Cationic | Free | Conjugation with CBD3 peptide of CRMP2 | NA | Peptide [Ca2+ channel binding domain 9CBD3)] | 23106100 |
| 2552 | YGRKKRRQRRR | ST9-104 | 11 | L | Linear | Protein derived | Cationic | Free | Conjugation with reverse sequence of CBD3 peptide of CRMP2 | NA | Peptide [Ca2+ channel binding domain 9CBD3)] | 23106100 |
| 2555 | YGDCLPHLKLCKENKDCCSKKCKRRGTNIEKRCR | I-TYR-L-Mca | 34 | L | Linear | Protein derived | Cationic | Conjugated with radio-ionized Tyr residue | Free | NA | Radiolabelled Iodine (125I) | 24667409 |
| 2558 | GRKKRRQRRR | Tm3+-DOTA-CAT | 10 | L | Linear | Protein derived | Cationic | Conjugated with Tm³⁺-DOTA via CAT recognition site | Free | NA | MRI probe [DOTA-caged metal ion (Tm³?)] | 23281285 |