Browse result page of AntiTbPdb
The total number entries retrieved from this search are 668
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1198 | Pinanediol PD-protected Boropentapeptide | AVKAA-BO2(PD) | Free | Conjugated with Boronic acid and pinanediol PD | Conjugated with Boronic acid and pinanediol PD | Linear | 5 | L | NA | Synthetic | NA | Mycobacterium thermoresistible | Mycobacterium thermoresistible | IC50 = 121.6 ± 25.3 μM for MycP1 | In vitro | None | NA | NA | None | NA | NA | Inhibit enzyme (MycP1) reponsible for cleavage of virulence factor (ESX secretion-associated protein B (EspB)) | Mycosin protease-1 (MycP1) | None | None | 2014 | 24915878 |
| antitb_1199 | Pinanediol PD-protected Boropentapeptide | AVKAA-BO2(PD) | Free | Conjugated with Boronic acid and pinanediol PD | Conjugated with Boronic acid and pinanediol PD | Linear | 5 | L | NA | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis | IC50 = 93.2±33.7 μM for MycP2 | In vitro | None | NA | NA | None | NA | NA | Inhibit enzyme (MycP1) reponsible for cleavage of virulence factor (ESX secretion-associated protein B (EspB)) | Mycosin protease-1 (MycP1) | None | None | 2014 | 24915878 |
| antitb_1200 | Pinanediol PD-protected Boropentapeptide | AVKAA-BO2(PD) | Free | Conjugated with Boronic acid and pinanediol PD | Conjugated with Boronic acid and pinanediol PD | Linear | 5 | L | NA | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | IC50 = 37.9±5.2 μM for MycP3 | In vitro | None | NA | NA | None | NA | NA | Inhibit enzyme (MycP1) reponsible for cleavage of virulence factor (ESX secretion-associated protein B (EspB)) | Mycosin protease-1 (MycP1) | None | None | 2014 | 24915878 |
| antitb_1219 | Cathelicidin HHC-10 | KRWWKWIRW | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium tuberculosis complex bacteria, Mycobacterium bovis bacille calmette guerin (BCG) (Mycobacterium bovis BCG Pasteur 1173P2) | 69 % decrease in CFU at 50 μg/ ml | Both | None | NA | NA | 8–9 weeks old C57BL/6 mice | CFUs in mouse lungs were reduced 77.8% at 1.25 mg | Significant reduction of IFN-γ transcription | Cell envelope disruption | Cell envelope | None | Antibacterial (such as Pseudomonas aeruginosa, Escherichia coli, Klebsiella pneumonia, and S. aureus etc | 2013 | 23231581 |
| antitb_1220 | Cathelicidin HHC-10 | KRWWKWIRW | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium tuberculosis complex bacteria, Mycobacterium bovis bacille calmette guerin (BCG) (Mycobacterium bovis BCG Pasteur 1173P2) | 88 % decrease in CFU at 100 μg/ ml | Both | None | NA | NA | 8–9 weeks old C57BL/6 mice | CFUs in mouse lungs were reduced 95.8% at 2.5 mg k | Significant reduction of IFN-γ transcription | Cell envelope disruption | Cell envelope | None | Antibacterial (such as Pseudomonas aeruginosa, Escherichia coli, Klebsiella pneumonia, and S. aureus etc | 2013 | 23231581 |
| antitb_1221 | PK34 | PRVIETKVHGREVTGLARNVSEENVDRLAKRWIK | Free | Free | None | Linear | 34 | L | Cationic | Synthetic | Searched and selected from mycobacteriophage genome sequences | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv strain (ATCC 27294 | MIC = 50 μg/ml | Both | Murine macrophage-like J774A.1 | NA | NA | Four-week-old female BALB/c mice | Dose of 20 mg (5×10−6 mol)/kg BW/d, PK34 had co | Inhibits the proinflammatory factor (IFN-γ, TNF-α, MCP-1, IL-6, IL-10, IL-12) production of macrophage cells induced by TDM. | Cell wall disruption | trehalose-6,6=-dimycolate (TDM) | None | None | 2013 | 23603838 |
| antitb_1222 | Peptide | SEFAYGSFVRTVSLPV | Conjugated with INH | Free | Conjugated with INH at N-terminal | Linear | 16 | L | NA | Protein Derived | 91−106 region of the heat shock protein (Hsp16.3) | None | None | NA | NA | NA | NA | NA | NA | NA | NA | Interact with Phospholipid Langmuir Monolayers and enhnaces the cell permating abiloity of INH | Phospholipid Langmuir Monolayers | Isoniazide (INH) | None | 2013 | 23679078 |
| antitb_1228 | High Activity Binding Peptides (HABPs) | TGMAALEQYLGSGHAVIVSI | Free | Free | None | Linear | 20 | L | NA | Protein Derived | From Rv1268c protein | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | In vitro | alveolar epithelial cells A549 (ATCC No. CCL-185) | Inhibited mycobacterial entry by up to 65%. | NA | None | NA | NA | Inhibit mycobacterial entry into cells | NA | None | None | 2013 | 23993672 |
| antitb_1229 | High Activity Binding Peptides (HABPs) | AVALGLASPADAAAGTMYGD | Free | Free | None | Linear | 20 | L | NA | Protein Derived | From Rv1268c protein | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | In vitro | U937 monocyte derived macrophages (ATCC No. CRL-1593.2) | Inhibited mycobacterial entry by up to 65%. | NA | None | NA | NA | Inhibit mycobacterial entry into cells | NA | None | None | 2013 | 23993672 |
| antitb_1230 | (LLKK)2 | LLKKLLKK | Free | Free | None | Linear | 8 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 125 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1231 | (LLKK)2 | LLKKLLKK | Free | Free | None | Linear | 8 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG lux | MIC = 500 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1232 | (LLKK)2 | LLKKLLKK | Free | Free | None | Linear | 8 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 500 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1233 | (LLKK)2 | LLKKLLKK | Free | Free | None | Linear | 8 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis CSU87 reistant to rifampicin, isoniazid, ethambutol, streptomycin and kanamycin | MIC > 500 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1234 | C(LLKK)2 | CLLKKLLKK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 62.5 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1235 | C(LLKK)2 | CLLKKLLKK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis resistant agianst rifampicin | MIC = 62.5 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1236 | C(LLKK)2 | CLLKKLLKK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG lux | MIC = 250 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1237 | C(LLKK)2 | CLLKKLLKK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 500 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1238 | C(LLKK)2 | CLLKKLLKK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis CSU87 reistant to rifampicin, isoniazid, ethambutol, streptomycin and kanamycin | MIC > 500 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1239 | (LLKK)2C | LLKKLLKKC | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 125 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1240 | C(LLKK)2C | CLLKKLLKKC | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 250 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1241 | M(LLKK)2 | MLLKKLLKK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 125 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1242 | (LLKK)2M | LLKKLLKKM | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 62.5 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1243 | (LLKK)2M | LLKKLLKKM | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis resistant agianst rifampicin | MIC = 62.5 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1244 | (LLKK)2M | LLKKLLKKM | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG lux | MIC = 500 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1245 | (LLKK)2M | LLKKLLKKM | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC > 500 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1246 | (LLKK)2M | LLKKLLKKM | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis CSU87 reistant to rifampicin, isoniazid, ethambutol, streptomycin and kanamycin | MIC = 125 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1247 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 62.5 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1248 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis (ATCC No. 14468) | MIC = 15.6 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | Rifampicin, shows synergy | Antibacterial | 2014 | 24314557 |
| antitb_1249 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis resistant agianst rifampicin | MIC = 62.5 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1250 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis resistant agianst rifampicin | MIC = 15.6 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | Rifampicin, shows synergy | Antibacterial | 2014 | 24314557 |
| antitb_1251 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG lux | MIC = 15.6 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1252 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG lux | MIC = 3.91 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | Rifampicin, shows synergy | Antibacterial | 2014 | 24314557 |
| antitb_1253 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 125 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1254 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 7.81 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | Rifampicin, shows synergy | Antibacterial | 2014 | 24314557 |
| antitb_1255 | M(LLKK)2M | MLLKKLLKKM | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis CSU87 reistant to rifampicin, isoniazid, ethambutol, streptomycin and kanamycin | MIC = 62.5 mg/L | In vitro | Rat red blood cells (rRBCs) | NA | Very low, i.e. 50% hemolysis concentration (HC50) > 1000 mg/L | None | NA | NA | Membrane-lytic mechanism | Cell envelope | None | Antibacterial | 2014 | 24314557 |
| antitb_1260 | RN3 (1-45) | RPPQFTRAQWFAIQHISLNPPRSTIAMRAINNYRWRSKNQNTFLR | Free | Free | None | Linear | 45 | L | Cationic | Protein Derived | From the N terminus of RNase 3 | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | MIC = 10.0 ± 0.5 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
| antitb_1261 | RN3 (1-45) | RPPQFTRAQWFAIQHISLNPPRSTIAMRAINNYRWRSKNQNTFLR | Free | Free | None | Linear | 45 | L | Cationic | Protein Derived | From the N terminus of RNase 4 | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | IC50 = 4.2 ± 0.2 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
| antitb_1262 | RN7 (1-45) | KPKGMTSSQWFKIQHMQPSPQASNSAMKNINKHTKRSKDLNTFLH | Free | Free | None | Linear | 45 | L | Cationic | Protein Derived | From the N terminus of RNase 7 | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | MIC = 20.0 ± 0.8 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
| antitb_1263 | RN7 (1-45) | KPKGMTSSQWFKIQHMQPSPQASNSAMKNINKHTKRSKDLNTFLH | Free | Free | None | Linear | 45 | L | Cationic | Protein Derived | From the N terminus of RNase 8 | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | IC50 = 9.5 ± 0.3 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
| antitb_1264 | Cecropin A-melittin (CA-M) hybrid peptide | KWKLFKKIGIGAVLKVLTTGLPALIS | Free | Amidation | None | Linear | 26 | L | Cationic | Protein Derived | Hybrid derived from cecropin A-melittin | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | MIC = 20.0 ± 1.0 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
| antitb_1265 | Cecropin A-melittin (CA-M) hybrid peptide | KWKLFKKIGIGAVLKVLTTGLPALIS | Free | Amidation | None | Linear | 26 | L | Cationic | Protein Derived | Hybrid derived from cecropin A-melittin | Mycobacterium vaccae | Mycobacterium vaccae strain (ATCC 15483) | IC50 = 10.3 ± 0.3 μM | In vitro | None | NA | NA | None | NA | NA | Membrane depolarization and permeabilization | Cell envelope | None | Antibacterial and Antiparasitic | 2013 | 23716047 |
| antitb_1266 | F91 | SEFAYGSFVRTVSLPVGADE | Free | Free | None | Linear | 20 | L | NA | Protein Derived | From 16kDa antigen | None | None | NA | In vivo | NA | NA | NA | Female BALB/c mice (6-8 wk, 20±2 g) | 20 nmol | It promotes the maturation of MHC-II and elicit secretion of IFN-Υ and also induce the expression of CD80, CD86 and CD40 co-stimulatory molecules and activate DCs to produce IL-6 and IL-12. | NA | NA | None | NA | 2013 | 24434326 |
| antitb_1267 | L91 | SEFAYGSFVRTVSLPVGADE | Free | Free | Conjugated to TLR2-ligand Pam2Cys | Linear | 20 | L | NA | Protein Derived | From 16kDa antigen | None | None | NA | In vivo | NA | NA | NA | Female BALB/c mice (6-8 wk, 20±2 g) | 20 nmol | It promotes the maturation of MHC-II and elicit secretion of IFN-Υ and also induce the expression of CD80, CD86 and CD40 co-stimulatory molecules and activate DCs to produce IL-6 and IL-12. | NA | NA | None | NA | 2013 | 24434326 |
| antitb_1268 | VapB30 (52-59) | ELAAIRHR | Free | Free | None | Linear | 8 | L | NA | Protein Derived | From VapB30 toxin | Mycobacterium tuberculosis | Mycobacterium tuberculosis (strain H37Rv) | NA | NA | NA | NA | NA | None | NA | NA | By disrupting the toxin-antitoxin complex (VapBC) | VapBC | None | NA | 2015 | 26150422 |
| antitb_1269 | VapC30 (14-30) | DEPDAERFEAAVEADHI | Free | Free | None | Linear | 17 | L | NA | Protein Derived | From VapC30 toxin | Mycobacterium tuberculosis | Mycobacterium tuberculosis (strain H37Rv) | NA | NA | NA | NA | NA | None | NA | NA | By disrupting the toxin-antitoxin complex (VapBC) | VapBC | None | NA | 2015 | 26150422 |
| antitb_1270 | VapC30 (48-56) | RFGEPGGRE | Free | Free | None | Linear | 9 | L | NA | Protein Derived | From VapC30 toxin | Mycobacterium tuberculosis | Mycobacterium tuberculosis (strain H37Rv) | NA | NA | NA | NA | NA | None | NA | NA | By disrupting the toxin-antitoxin complex (VapBC) | VapBC | None | NA | 2015 | 26150422 |
| antitb_1271 | Inhibitor 1 | PK-(boroMet) | Acetylation | Free | boroMet = methionine boronic acid | Linear | 3 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 12 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
| antitb_1272 | Inhibitor 2 | HK-(boroMet) | Acetylation | Free | boroMet = methionine boronic acid | Linear | 3 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 6 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
| antitb_1273 | Inhibitor 3 | AK-(boroMet) | Acetylation | Free | boroMet = methionine boronic acid | Linear | 3 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 3 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |
| antitb_1274 | Inhibitor 4 | Ala(1-naphtyl)-K-boroLeu | Free | Free | Ala(1-naphtyl) = 1-napthylalanine, boroLeu = leucine boronic acid | Linear | 3 | L | NA | Synthetic | substrate-based boronate inhibitors | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC50 = 12 μM | In vitro | Myeloma cells (MM1.S) | NA | No cytotoxicty | None | NA | NA | Inhibit ClpP1P2 peptidase activity and protein degradation in the presence of ClpC1 and ClpX ATPases. | ClpP1P2 peptidase | None | None | 2015 | 25759383 |