• 011-26907444
  • raghava@iiitd.ac.in

Browse result page of AntiTbPdb

The total number entries retrieved from this search are 668
IDNameSequenceN-Terminal ModificationC-Terminal ModificationChemical ModificationLinear/CyclicLengthChiralityNatureSourceOriginSpeciesStrainInhibition ConcentrationIn vitro/ In vivoCell LineIntracellular InhibitionCytotoxicityAnimal ModelEffective Dose in model organismImmune ResponceMechanism of ActionTargetCombination TherapyOther ActivitiesYear of PublicationPubmed ID/ Patent No.
antitb_1401LLKKK-18KEFKRIVKRIKKFLRKLV FreeFreeNoneLinear19LCationicNaturalMurine macrophagesMycobacteria smegmatisM. smegmatis mc2 155MIC = 1μg /mlin vitroJ774.A1 macrophage cell lines51% bacteria is cleared NANA NANANANANANA201121790937
antitb_1402LLKKK-18KEFKRIVKRIKKFLRKLV FreeFreeNoneLinear19LCationicNaturalMurine macrophagesMycobacteria smegmatisM. smegmatis mc2 155MIC = 25μg/mlin vitroJ774.A1 macrophage cell lines80% bacteria is clearedNANA NANANANANANA201121790937
antitb_1403LL-37[LL-37, 37 aa] FreeFreeNoneLinear38LCationicNaturalMurine macrophagesMycobacterium tuberculosisMycobacterium tuberculosis H37RvMIC = 25μg/ml (24 hours incubation)in vitroNANANANA NANANANANANA201121790937
antitb_1404LL-37[LL-37, 37 aa] FreeFreeNoneLinear38LCationicNaturalMurine macrophagesMycobacterium tuberculosisMycobacterium tuberculosis H37RvMIC = 100 μg/mL (72 hours incubation)in vitroNANANANA NANANANANANA201121790937
antitb_1405D-LAK120KKLALLALKKWLLALKKLALLALKKFreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis susceptible strainNAin vitroNANANANA NANANANANANA201425154927
antitb_1406D-LAK120KKLALLALKKWLLALKKLALLALKKFreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis MDR strainMIC = 50 μMin vitroNANANANA NANANANANANA201425154927
antitb_1407D-LAK120-P13KKLALLALKKWLPALKKLALLALKKFreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis MDR strainMIC = 100 μMin vitroNANANANA NANANANANANA201425154927
antitb_1408D-LAK120-AKKLALALAKKWLALAKKLALALAKKFreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis MDR strainMIC = 25 μMin vitroNANANANA NANANANANANA201425154927
antitb_1409D-LAK120-HP13KKALAHALKKWLPALKKLAHALAKKFreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis MDR strainMIC = 25 μMin vitroNANANANA NANANANANANA201425154927
antitb_1410D-LAK120-HKKLALHALKKWLHALKKLAHLALKKFreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis MDR strainNAin vitroNANANANA NANANANANANA201425154927
antitb_1411D-LAK120KKLALLALKKWLLALKKLALLALKKFreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis XDR strainMIC = 50 μMin vitroNANANANA NANANANANANA201425154927
antitb_1412D-LAK120-P13KKLALLALKKWLPALKKLALLALKKFreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis XDR strainMIC = 100 μMin vitroNANANANA NANANANANANA201425154927
antitb_1413D-LAK120-AKKLALALAKKWLALAKKLALALAKKFreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis XDR strainMIC = 100 μMin vitroNANANANA NANANANANANA201425154927
antitb_1414D-LAk120-AP13KKLALALAKKWLPLAKKLALALAKK FreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis XDR strainNAin vitroNANANANA NANANANANANA201425154927
antitb_1415D-LAK120-HKKLALHALKKWLHALKKLAHLALKKFreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis XDR strainMIC = 100 μMin vitroNANANANA NANANANANANA201425154927
antitb_1416D-LAK120-HP13KKALAHALKKWLPALKKLAHALAKKFreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis XDR strain50 μMin vitroNANANANA NANANANANANA201425154927
antitb_1417D-LAK120KKLALLALKKWLLALKKLALLALKKFreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis XDR strainNAin vitroTHP-1 cell lineEC50(effective concentration) =14.4 ± 3.3 μMNo cytotoxicityNA NANANANANANA201425154927
antitb_1418D-LAK120-P13KKLALLALKKWLPALKKLALLALKKFreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis XDR strainNAin vitroTHP-1 cell lineEC50 =17.9 ± 1.7 μMNo cytotoxicityNA NANANANANANA201425154927
antitb_1419D-LAK120-AKKLALALAKKWLALAKKLALALAKKFreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis XDR strainNAin vitroTHP-1 cell lineEC50 = 31.9 ± 9.5 μMCytotoxic at > 25 μMNA NANANANANANA201425154927
antitb_1420D-LAk120-AP13KKLALALAKKWLPLAKKLALALAKK FreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis XDR strainNAin vitroTHP-1 cell lineEC50 = 32.1 ± 4.8 μMCytotoxic at > 25 μMNA NANANANANANA201425154927
antitb_1421D-LAK120-HKKLALHALKKWLHALKKLAHLALKKFreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis XDR strainNAin vitroTHP-1 cell lineEC50 = 32.2 ± 5.5 μMCytotoxic at12.5 μM NA NANANANANANA201425154927
antitb_1422D-LAK120-HP13KKALAHALKKWLPALKKLAHALAKKFreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis XDR strainNAin vitroTHP-1 cell lineEC50 = 32.3 ± 4.7 μMCytotoxic above 3.13 μM NA NANANANANANA201425154927
antitb_1423D-LAK120-HKKLALHALKKWLHALKKLAHLALKKFreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis MDR strain GB2NAEx vivoTHP-1 cell lineNACytotoxic at > 25 μMNA NANANANANANA201425154927
antitb_1424D-LAK120-HP13KKALAHALKKWLPALKKLAHALAKKFreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis MDR strain GB2NAEx vivoTHP-1 cell lineNACytotoxic at > 25 μMNA NANANANANANA201425154927
antitb_1425D-LAK120-AKKLALALAKKWLALAKKLALALAKKFreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis MDR strain GB2NAEx vivoTHP-1 cell lineNACytotoxic at12.5 μM NA NANANANANANA201425154927
antitb_1426D-LAk120-AP13KKLALALAKKWLPLAKKLALALAKK FreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis MDR strain GB2NAEx vivoTHP-1 cell lineNACytotoxic above 3.13 μM NA NANANANANANA201425154927
antitb_1427D-LAK120-HKKLALHALKKWLHALKKLAHLALKKFreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis XDR strain WYC-11NAEx vivoTHP-1 cell lineNACytotoxic at > 25 μMNA NANANANANANA201425154927
antitb_1428D-LAK120-HP13KKALAHALKKWLPALKKLAHALAKKFreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis XDR strain WYC-11NAEx vivoTHP-1 cell lineNACytotoxic at > 25 μMNA NANANANANANA201425154927
antitb_1429D-LAK120-AKKLALALAKKWLALAKKLALALAKKFreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis XDR strain WYC-11NAEx vivoTHP-1 cell lineNACytotoxic at12.5 μM NA NANANANANANA201425154927
antitb_1430D-LAk120-AP13KKLALALAKKWLPLAKKLALALAKK FreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis XDR strain WYC-11NAEx vivoTHP-1 cell lineNACytotoxic above 3.13 μM NA NANANANANANA201425154927
antitb_1431D-LAk120-AP13KKLALALAKKWLPLAKKLALALAKK FreeFreeNoneLinear25LCationicSyntheticNAMycobacterium tuberculosisMycobacterium tuberculosis XDR strain WYC-11MIC = 3.13 μMIn vitroTHP-1 cell lineNANANA NANANANAINH+D-LAK120-HP13NA201425154927
antitb_1439A2-TB10.4 IMYNYPAML FreeFreeNoneLinear9LNAProtein derivedMTB derived protein TB10.4Mycobacterium tuberculosisMycobacterium tuberculosis RvNANANANANANA NAIL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatmentDrug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. CD8+ T-cellNANA210425809751
antitb_1440A2-TB10.4 AMLGHAGDM FreeFreeNoneLinear9LNAProtein derivedMTB derived protein TB10.4Mycobacterium tuberculosisMycobacterium tuberculosis RvNANANANANANA NAIL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatmentDrug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. CD8+ T-cellNANA210425809751
antitb_1441A2-TB10.4 MLGHAGDMA FreeFreeNoneLinear9LNAProtein derivedMTB derived protein TB10.4Mycobacterium tuberculosisMycobacterium tuberculosis RvNANANANANANA NAIL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatmentDrug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. CD8+ T-cellNANA210425809751
antitb_1442A2-Ag85B YLLDGLRAQ FreeFreeNoneLinear9LNAProtein derivedMTB derived protein Ag85B Mycobacterium tuberculosisMycobacterium tuberculosis RvNANANANANANA NAIL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatmentDrug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. CD8+ T-cellNANA210425809751
antitb_1443A2-Ag85B KLVANNTRL FreeFreeNoneLinear9LNAProtein derivedMTB derived protein Ag85B Mycobacterium tuberculosisMycobacterium tuberculosis RvNANANANANANA NAIL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatmentDrug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. CD8+ T-cellNANA210425809751
antitb_1444A2-Ag85B FIYAGSLSA FreeFreeNoneLinear9LNAProtein derivedMTB derived protein Ag85B Mycobacterium tuberculosisMycobacterium tuberculosis RvNANANANANANA NAIL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatmentDrug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. CD8+ T-cellNANA210425809751
antitb_1445A2-ESAT6 AMASTEGNV FreeFreeNoneLinear9LNAProtein derivedMTB derived protein ESAT6 Mycobacterium tuberculosisMycobacterium tuberculosis RvNANANANANANA NAIL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatmentDrug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. CD8+ T-cellNANA210425809751
antitb_1446A2-ESAT LLDEGKQSL FreeFreeNoneLinear9LNAProtein derivedMTB derived protein ESAT6 Mycobacterium tuberculosisMycobacterium tuberculosis RvNANANANANANA NAIL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatmentDrug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. CD8+ T-cellNANA210425809751
antitb_1447A2-Rv2958 ALADLPVTV FreeFreeNoneLinear9LNAProtein derivedMTB derived protein Rv2958 Mycobacterium tuberculosisMycobacterium tuberculosis Rv2958 NANANANANANA NAIL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatmentDrug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. CD8+ T-cellNANA210425809751
antitb_1448A2-Rv2957 SIIIPTLNV FreeFreeNoneLinear9LNAProtein derivedMTB derived protein Rv2958 Mycobacterium tuberculosisMycobacterium tuberculosis Rv2958 NANANANANANA NAIL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatmentDrug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. CD8+ T-cellNANA210425809751
antitb_1449A2-Rv0447 VLAGSVDEL FreeFreeNoneLinear9LNAProtein derivedMTB derived protein Rv0447 Mycobacterium tuberculosisMycobacterium tuberculosis Rv0447NANANANANANA NAIL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatmentDrug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. CD8+ T-cellNANA210425809751
antitb_1450A24-TB10.4 IMYNYPAML FreeFreeNoneLinear9LNAProtein derivedMTB derived protein Rv0447 Mycobacterium tuberculosisMycobacterium tuberculosis Rv0447NANANANANANA NAIL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatmentDrug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. CD8+ T-cellNANA210425809751
antitb_1451A24-Ag85B WYYQSGLSI FreeFreeNoneLinear9LNAProtein derivedMTB derived protein Ag85B Mycobacterium tuberculosisMycobacterium tuberculosis RvNANANANANANA NAIL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatmentDrug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. CD8+ T-cellNANA210425809751
antitb_1452A24-Ag85B FLTSELPQW FreeFreeNoneLinear9LNAProtein derivedMTB derived protein Ag85B Mycobacterium tuberculosisMycobacterium tuberculosis RvNANANANANANA NAIL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatmentDrug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. CD8+ T-cellNANA210425809751
antitb_1453A24-Ag85B IYAGSLSAL FreeFreeNoneLinear9LNAProtein derivedMTB derived protein Ag85B Mycobacterium tuberculosisMycobacterium tuberculosis RvNANANANANANA NAIL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatmentDrug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. CD8+ T-cellNANA210425809751
antitb_1454A24-ESAT6 AYQGVQQKW FreeFreeNoneLinear9LNAProtein derivedMTB derived protein ESAT6 Mycobacterium tuberculosisMycobacterium tuberculosis RvNANANANANANA NAIL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatmentDrug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. CD8+ T-cellNANA210425809751
antitb_1455A24-ESAT6 ELNNALQNL FreeFreeNoneLinear9LNAProtein derivedMTB derived protein ESAT6 Mycobacterium tuberculosisMycobacterium tuberculosis RvNANANANANANA NAIL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatmentDrug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. CD8+ T-cellNANA210425809751
antitb_1456A24-Rv2958 KYIAADRKI FreeFreeNoneLinear9LNAProtein derivedMTB derived protein Rv2958 Mycobacterium tuberculosisMycobacterium tuberculosis Rv2958 NANANANANANA NAIL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatmentDrug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. CD8+ T-cellNANA210425809751
antitb_1457A24-Rv2957 PYNLRYRVL FreeFreeNoneLinear9LNAProtein derivedMTB derived protein Rv2958 Mycobacterium tuberculosisMycobacterium tuberculosis Rv2958 NANANANANANA NAIL7Rα expression reduced and CD107a expression also decreased among CD8+ T cell after post TB treatmentDrug treatement of TB with antiTB drug found to decrease the frequency of MTB Antigen CD8+ T-cell, so evaluation of these antigenic peptide after TB treatment serve as a valuable marker for the evaluation of TB therapy. CD8+ T-cellNANA210425809751