Browse result page of AntiTbPdb
The total number entries retrieved from this search are 668
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1550 | Lacticin 3147 | AA-(Dhb)-N-(Dhb)-FALADYWGNNGAWA-(Abu)-L-(Abu)-HEAMAWAK | Free | Free | Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid | Linear | 30 | L | Cationic | Natural | Derived from Lactococcus lactis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Ra | IC90= 7.5 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 25613372 |
| antitb_1551 | Lacticin 3147 | AA-(Dhb)-N-(Dhb)-FALADYWGNNGAWA-(Abu)-L-(Abu)-HEAMAWAK | Free | Free | Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid | Linear | 30 | L | Cationic | Natural | Derived from Lactococcus lactis | Mycobacterium avium | Mycobacterium avium | IC90= 60 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 25613372 |
| antitb_1552 | Lacticin 3147 | AA-(Dhb)-N-(Dhb)-FALADYWGNNGAWA-(Abu)-L-(Abu)-HEAMAWAK | Free | Free | Dhb= Didehydroaminobutyric acid, Abu= 2-aminobutyric acid | Linear | 30 | L | Cationic | Natural | Derived from Lactococcus lactis | Mycobacterium Kansaii | Mycobacterium Kansaii | IC90= 15 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 25613372 |
| antitb_1553 | E50-52 | TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from Enterococcus faecalis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC= 0.1mg/L (within macrophage) | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 25613372 |
| antitb_1554 | E50-52 | TTKNYGNGVCNSVNWCQCGNVWASCNLATGCAAWLCKLA | Free | Free | None | Linear | 39 | L | Cationic | Natural | Derived from Enterococcus faecalis | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 1μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 25613372 |
| antitb_1555 | Pk34 | PRVIETKVHGREVTGLARNVSEENVDRLAKRWIK | Free | Free | None | Linear | 34 | L | Cationic | Mycobacteriophage derived | Derived from mycobacteriophage | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | IC50= 50 μg/ml | in vitro | NA | NA | Macrophage like J774A.1 cell line | BALB/C mice | 20mg/Kg | Increase production of cytokine like IFN-γ,TNF-α,IL-12,MCp-1, IL-10, IL-6 | NA | NA | NA | Bactericidal against E.coli, pseudomonas, S.aureus, Bacillus subtilis | 2015 | 25613372 |
| antitb_1557 | Vgf-1 | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG | Free | Free | None | Linear | 59 | L | NA | Natural | Derived from snake venom N.atra | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH) DR-i | MIC = 8.5 ± 0.1 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2003 | 12927960 |
| antitb_1558 | Vgf-1 | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG | Free | Free | None | Linear | 59 | L | NA | Natural | Derived from snake venom N.atra | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH+Rif) DR-ir | MIC = 8.5 ± 0.1 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2004 | 12927960 |
| antitb_1559 | Vgf-1 | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG | Free | Free | None | Linear | 59 | L | NA | Natural | Derived from snake venom N.atra | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH+Streptomycin) DR-is | MIC = 8.5 ± 0.1 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2005 | 12927960 |
| antitb_1560 | Vgf-1 | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG | Free | Free | None | Linear | 59 | L | NA | Natural | Derived from snake venom N.atra | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH+Streptomycin) DR-is | MIC = 8.5 ± 0.1 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2006 | 12927960 |
| antitb_1561 | Vgf-1 | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG | Free | Free | None | Linear | 59 | L | NA | Natural | Derived from snake venom N.atra | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH+Rif+Streptomycin) DR-irs | MIC = 8.5 ± 0.1 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2007 | 12927960 |
| antitb_1562 | Vgf-1 | ECYRKSDIVTCEPWQKFCYREVTFFPNHPVYLSGCASECTETNSKWCCTTDKCNRARGG | Free | Free | None | Linear | 59 | L | NA | Natural | Derived from snake venom N.atra | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC25618 (resistant to INH+Rif+Streptomycin+ehambutol) DR-irse | MIC = 8.5 ± 0.1 mg/L | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2008 | 12927960 |
| antitb_1607 | TP-5 | RKDVY | Free | Amidation | None | Linear | 4 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-susceptible | MIC = > 1000mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1608 | RR-6 | RRRRRR | Free | Amidation | None | Linear | 5 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-susceptible | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1609 | RR-11 | RKDVYRRRRRR | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-susceptible | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1610 | RY-11 | RRRRRRRKDVY | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-susceptible | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1611 | TP-5 | RKDVY | Free | Amidation | None | Linear | 4 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | NA | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1612 | RR-6 | RRRRRR | Free | Amidation | None | Linear | 5 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1613 | RR-11 | RKDVYRRRRRR | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1614 | RY-11 | RRRRRRRKDVY | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1615 | RY-11 | RRRRRRRKDVY | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | RR-11 Peptide(31.25 mg/L) + Rifampicin (1.95mg/L) | NA | 2014 | 24411680 |
| antitb_1616 | LK | LLKKLLKK | Free | Amidation | None | Linear | 8 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 125 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
| antitb_1617 | PP | PLLKKLLKKP | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 250 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
| antitb_1618 | CC | CLLKKLLKKC | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 250 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
| antitb_1619 | II | ILLKKLLKKI | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 62.5 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
| antitb_1620 | MM | MLLKKLLKKM | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 62.5 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
| antitb_1621 | WW | WLLKKLLKKW | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 62.5 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
| antitb_1622 | LK | LLKKLLKK | Free | Amidation | None | Linear | 8 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 62.5 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |
| antitb_1623 | PP | PLLKKLLKKP | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 125 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |
| antitb_1624 | CC | CLLKKLLKKC | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 250 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |
| antitb_1625 | II | ILLKKLLKKI | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 15.6 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |
| antitb_1626 | MM | MLLKKLLKKM | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 15.6 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |
| antitb_1627 | WW | WLLKKLLKKW | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 0.98 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |
| antitb_1628 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 37 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacteria smegmatis mc2 155 | MIC = 2400 μg/ml | in vitro | J774 macrophage cell lines | NA | IC50= 11226 μg/ml | NA | NA | Stimulation of TNF-α production | inhibit bacterial Atpase activity | NA | NA | NA | 2015 | 26218806 |
| antitb_1629 | LLAP | RKSAKKIGKRAKR | Free | Free | None | Linear | 13 | L | Cationic | Natural | NA | Mycobacterium smegmatis | Mycobacteria smegmatis mc2 155 | MIC = 600 μg/ml | in vitro | J774 macrophage cell lines | NA | IC50= 11226 μg/ml | NA | NA | Stimulation of TNF-α production | inhibit bacterial Atpase activity | NA | NA | NA | 2015 | 26218806 |
| antitb_1653 | NA | WKWLKKWIK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv | IC90 = 1.5 μg/ml | in vitro | Human THP-1 cell lines | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 2016 | 26645944 |
| antitb_1723 | SEQ ID NO 3 | NVTSIHSLL | Free | Free | None | Linear | 9 | L | NA | Protein Derived | From the proetins containing mycobacterial CD8 T cell epitopes | Mycobacterium tuberculosis | Mycobacterium tuberculosis | NA | In vitro | PBMcs | NA | NA | β2-microglobulin gene knowckout mice, TAP-1 null mutant mice and HSP-65 immunized mice | NA | IFN-γ release increases | By CD8 T cell response | NA | None | None | 2002 | US 2002/013197 |
| antitb_1724 | SEQ ID NO 4 | ELNNALQNLART | Free | Free | None | Linear | 12 | L | NA | Protein Derived | From the proetins containing mycobacterial CD8 T cell epitopes | Mycobacterium tuberculosis | Mycobacterium tuberculosis | NA | In vitro | PBMcs | NA | NA | β2-microglobulin gene knowckout mice, TAP-1 null mutant mice and HSP-65 immunized mice | NA | IFN-γ release increases | By CD8 T cell response | NA | None | None | 2002 | US 2002/013197 |
| antitb_1725 | SEQ ID NO 7 | SGSEAYQGVQQKWDA | Free | Free | None | Linear | 15 | L | NA | Protein Derived | From the proetins containing mycobacterial CD8 T cell epitopes | Mycobacterium tuberculosis | Mycobacterium tuberculosis | NA | In vitro | PBMcs | NA | NA | β2-microglobulin gene knowckout mice, TAP-1 null mutant mice and HSP-65 immunized mice | NA | IFN-γ release increases | By CD8 T cell response | NA | None | None | 2002 | US 2002/013197 |
| antitb_1726 | SEQ ID NO 8 | TATELNNAL | Free | Free | None | Linear | 9 | L | NA | Protein Derived | From the proetins containing mycobacterial CD8 T cell epitopes | Mycobacterium tuberculosis | Mycobacterium tuberculosis | NA | In vitro | PBMcs | NA | NA | β2-microglobulin gene knowckout mice, TAP-1 null mutant mice and HSP-65 immunized mice | NA | IFN-γ release increases | By CD8 T cell response | NA | None | None | 2002 | US 2002/013197 |
| antitb_1727 | SEQ ID NO 9 | RTISEAGQAM | Free | Free | None | Linear | 10 | L | NA | Protein Derived | From the proetins containing mycobacterial CD8 T cell epitopes | Mycobacterium tuberculosis | Mycobacterium tuberculosis | NA | In vitro | PBMcs | NA | NA | β2-microglobulin gene knowckout mice, TAP-1 null mutant mice and HSP-65 immunized mice | NA | IFN-γ release increases | By CD8 T cell response | NA | None | None | 2002 | US 2002/013197 |
| antitb_1728 | SEQ ID NO 10 | AYQGVQQKW | Free | Free | None | Linear | 9 | L | NA | Protein Derived | From the proetins containing mycobacterial CD8 T cell epitopes | Mycobacterium tuberculosis | Mycobacterium tuberculosis | NA | In vitro | PBMcs | NA | NA | β2-microglobulin gene knowckout mice, TAP-1 null mutant mice and HSP-65 immunized mice | NA | IFN-γ release increases | By CD8 T cell response | NA | None | None | 2002 | US 2002/013197 |
| antitb_1729 | SEQ ID NO 11 | SEAYQGVQQ | Free | Free | None | Linear | 9 | L | NA | Protein Derived | From the proetins containing mycobacterial CD8 T cell epitopes | Mycobacterium tuberculosis | Mycobacterium tuberculosis | NA | In vitro | PBMcs | NA | NA | β2-microglobulin gene knowckout mice, TAP-1 null mutant mice and HSP-65 immunized mice | NA | IFN-γ release increases | By CD8 T cell response | NA | None | None | 2002 | US 2002/013197 |
| antitb_1730 | SEQ ID NO 12 | SEAYQGVQQK | Free | Free | None | Linear | 10 | L | NA | Protein Derived | From the proetins containing mycobacterial CD8 T cell epitopes | Mycobacterium tuberculosis | Mycobacterium tuberculosis | NA | In vitro | PBMcs | NA | NA | β2-microglobulin gene knowckout mice, TAP-1 null mutant mice and HSP-65 immunized mice | NA | IFN-γ release increases | By CD8 T cell response | NA | None | None | 2002 | US 2002/013197 |
| antitb_1731 | Seq ID No 10 | KMHATNHGGGS | Free | Free | None | Linear | 11 | L | NA | Synthetic | From random peptide libraries diplayed on bacteriophage M13 | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 100 μM completely inhibits the cahpaeron activity of Hsp 16.3 | In vitro | Mouse bone marrow derive dmacrophages and THP-1 | NA | NA | None | NA | NA | Inhibit chaperon activity of heat shock protein 16.3 (Hsp 16.3) | Heat shock protein (Hsp 16.3) | None | None | 2007 | US 2007/003721 |
| antitb_1732 | Seq ID No 22 | YPHHFKHRHIPIGGGS | Free | Free | None | Linear | 16 | L | NA | Synthetic | From random peptide libraries diplayed on bacteriophage M14 | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 100 μM completely inhibits the cahpaeron activity of Hsp 16.3 | In vitro | Mouse bone marrow derive dmacrophages and THP-1 | NA | NA | None | NA | NA | Inhibit chaperon activity of heat shock protein 16.3 (Hsp 16.3) | Heat shock protein (Hsp 16.3) | None | None | 2007 | US 2007/003721 |
| antitb_1733 | Seq ID No 1 | GVENVSW | Free | Free | None | Linear | 7 | L | NA | Synthetic | From random peptide libraries diplayed on bacteriophage M15 | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 100 μM completely inhibits the cahpaeron activity of Hsp 16.3 | In vitro | Mouse bone marrow derive dmacrophages and THP-1 | NA | NA | None | NA | NA | Inhibit chaperon activity of heat shock protein 16.3 (Hsp 16.3) | Heat shock protein (Hsp 16.3) | None | None | 2007 | US 2007/003721 |
| antitb_1734 | Seq ID No 2 | KMHATNH | Free | Free | None | Linear | 7 | L | NA | Synthetic | From random peptide libraries diplayed on bacteriophage M16 | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 100 μM completely inhibits the cahpaeron activity of Hsp 16.3 | In vitro | Mouse bone marrow derive dmacrophages and THP-1 | NA | NA | None | NA | NA | Inhibit chaperon activity of heat shock protein 16.3 (Hsp 16.3) | Heat shock protein (Hsp 16.3) | None | None | 2007 | US 2007/003721 |
| antitb_1735 | Seq ID No 9 | KMHATNHGGGS | Free | Free | None | Linear | 11 | L | NA | Synthetic | From random peptide libraries diplayed on bacteriophage M17 | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 100 μM completely inhibits the cahpaeron activity of Hsp 16.3 | In vitro | Mouse bone marrow derive dmacrophages and THP-1 | NA | NA | None | NA | NA | Inhibit chaperon activity of heat shock protein 16.3 (Hsp 16.3) | Heat shock protein (Hsp 16.3) | None | None | 2007 | US 2007/003721 |
| antitb_1736 | Seq ID No 21 | YPHHFKHRHIPI | Free | Free | None | Linear | 12 | L | NA | Synthetic | From random peptide libraries diplayed on bacteriophage M18 | Mycobacterium tuberculosis | Mycobacterium tuberculosis | 100 μM completely inhibits the cahpaeron activity of Hsp 16.3 | In vitro | Mouse bone marrow derive dmacrophages and THP-1 | NA | NA | None | NA | NA | Inhibit chaperon activity of heat shock protein 16.3 (Hsp 16.3) | Heat shock protein (Hsp 16.3) | None | None | 2007 | US 2007/003721 |