Browse result page of AntiTbPdb
The total number entries retrieved from this search are 668
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1325 | 1-C134mer | H-Ntridec-NLys-Nspe-Nspe-NLys-NH2 | Free | Amidation | Nlys = N-(4-aminobutyl)glycine, Nspe = (S)-N-(1-phenylethyl)glycine, Ntridec = N-(tridecyl)glycine | Linear | 5 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 6.3 μM | In vitro | Raw 264.7 and J774 mouse macrophage | NA | LD50 = >100 μM | NA | NA | NA | NA | NA | NA | NA | 2011 | 21464254 |
| antitb_1326 | 14mer | H-NLys-Nspe-Nspe-NLys-NH2 | Free | Amidation | Nlys = N-(4-aminobutyl)glycine, Nspe = (S)-N-(1-phenylethyl)glycine | Linear | 4 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = >100 μM | In vitro | Raw 264.7 and J774 mouse macrophage | NA | Non toxic | NA | NA | NA | NA | NA | NA | NA | 2011 | 21464254 |
| antitb_1327 | 1-Pro9 | H-(NLys-Nspe-Nspe)2-NLys-Nspe-L-Pro-NLys-Nspe-Nspe-NH2 | Free | Amidation | Nlys = N-(4-aminobutyl)glycine, Nspe = (S)-N-(1-phenylethyl)glycine | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 12.5-25 μM | In vitro | Raw 264.7 and J774 mouse macrophage | NA | LD50 = 50μM | NA | NA | NA | NA | NA | NA | NA | 2011 | 21464254 |
| antitb_1328 | 1-11mer | H-(NLys-Nspe-Nspe)3-NLys-Nspe-NH2 | Free | Amidation | Nlys = N-(4-aminobutyl)glycine, Nspe = (S)-N-(1-phenylethyl)glycine | Linear | 11 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 12.5-25 μM | In vitro | Raw 264.7 and J774 mouse macrophage | NA | LD50 = 50μM | NA | NA | NA | NA | NA | NA | NA | 2011 | 21464254 |
| antitb_1329 | 1-Nssb | H-(NLys-Nssb-Nssb)4-NH2 | Free | Amidation | Nlys = N-(4-aminobutyl)glycine, Nssb = (S)-N-(sec-butyl)glycine | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = >100 μM | In vitro | Raw 264.7 and J774 mouse macrophage | NA | Non toxic | NA | NA | NA | NA | NA | NA | NA | 2011 | 21464254 |
| antitb_1330 | Human beta casein fragment (54-59) | VEPIPY | Free | Free | None | Linear | 6 | L | Cationic | Protein derived | Human beta casein protein | Mycobacterium bovis | Mycobacterium bovis BCG | MIC = 25μM | in vitro | THP 1 cell lines | Cells treated with 10 mM and 20 mM peptide showed 17.13% and 29.56% increase in clearance of BCG | NA | NA | NA | Increase expression of IL-8, MCP-1, MIP-1β, TNF-α | NA | NA | NA | NA | 2012 | 23029305 |
| antitb_1331 | Innate defence regulator peptide HH2 | VQLRIRVAVIRA | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | Both | Human U937 promonocytic cell line | NA | None | BALB/C | 32 mg in 100 mL of saline solution (1 mg/kg) | Increase expression of MCP-1,Gro-α and TNF-α | NA | NA | NA | Antimicrobial against plasmodium aeruginosa/ S. aureus | 2012 | 23555622 |
| antitb_1332 | Innate defence regulator peptide 1002 | VQRWLIVWRIRK | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 29.3 ± 11.8 mg/mL | Both | Human U937 promonocytic cell line | NA | None | BALB/C | 32 mg in 100 mL of saline solution (1 mg/kg) | Increase expression of MCP-1,Gro-α and TNF-α | NA | NA | NA | Antimicrobial against plasmodium aeruginosa/ S. aureus | 2012 | 23555622 |
| antitb_1333 | Innate defence regulator peptide 1018 | VRLIVAVRIWRR | Free | Free | None | Linear | 12 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 16.4± 5.4 mg/mL | Both | Human U937 promonocytic cell line | NA | None | BALB/C | 32 mg in 100 mL of saline solution (1 mg/kg) | Increase expression of MCP-1,Gro-α and TNF-α | NA | NA | NA | Antimicrobial against plasmodium aeruginosa/ S. aureus | 2012 | 23555622 |
| antitb_1344 | Tenecin 1 fragment 1-15 | VTCDILSVEAKGVKL | Free | Amidation | None | Linear | 15 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 607 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | None | 1998 | 9693108 |
| antitb_1346 | Tenecin 1 fragment 16-32 | DAACAAHCLFR | Free | Amidation | None | Linear | 11 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 609 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | NA | 1998 | 9693108 |
| antitb_1347 | Tenecin 1 fragment 29-43 | NDAACAAHCLFRGRSGG | Free | Amidation | None | Linear | 17 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 610 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | Antibacterial against MRSA, bacillus subtilis, E.coli, Shigella at 10-30 μg/ml | 1998 | 9693108 |
| antitb_1348 | Tenecin 1 Fragment 33-42 | RSGGYCNGKRVCVCR | Free | Amidation | None | Linear | 15 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 611 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | Antibacterial against MRSA, bacillus subtilis, E.coli, Shigella at 10-30 μg/ml | 1998 | 9693108 |
| antitb_1350 | Tenecin 1 Fragment 34-43 | YCNGKRVCVCR | Free | Amidation | None | Linear | 11 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 613 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | Cytotoxic at >10 μg/ml | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | None | 1998 | 9693108 |
| antitb_1351 | Tenecin 1 Fragment 35-43 | CNGKRVCVCR | Free | Amidation | None | Linear | 10 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 614 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | Membrane disruption as reported by membrane leaky assay | NA | NA | None | 1998 | 9693108 |
| antitb_1352 | Tenecin 1 Fragment 34-42 | NGKRVCVCR | Free | Amidation | None | Linear | 9 | NA | NA | Natural | Larvae of tenebrio molitor(beetle) | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 615 | MIC = >100 μg/ml | in vitro | Human erythrocyte | NA | None | NA | NA | NA | NA | NA | NA | None | 1998 | 9693108 |
| antitb_1353 | Peptide KSl | KKVVFKVKFK | Free | Free | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC 607 | MIC = 6.25μg/ml | In vitro | Mouse erythrocyte | NA | None | NA | NA | NA | NA | NA | NA | antifungal, antibacterial against C.albicans | 1998 | 9756752 |
| antitb_1358 | Gran F1 | VSNAATRVCRTGRSRWRDVCRNFMRRYQSR | Free | Free | None | Linear | 30 | L | NA | Natural | Human cytolytic lymphocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC 25622 | IC90 = 30 μM | In vitro | Human erythroleukaemia cell line K562 | NA | 34 % cytolytic activity in range of 3 -7 μM peptide concentration | NA | NA | NA | NA | NA | NA | Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus | 1999 | 10585872 |
| antitb_1359 | Granulysin | TQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQG | Free | Free | None | Linear | 38 | L | NA | Natural | Human cytolytic lymphocytes | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv ATCC 25623 | IC90 = 30 μM | In vitro | Human erythroleukaemia cell line K562 | NA | 35 % cytolytic activity in range of 3 -7 μM peptide concentration | NA | NA | NA | NA | NA | NA | Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus | 1999 | 10585872 |
| antitb_1360 | Pleurocidin | GWGSFFKKAAHVGKHVGKAALTHYL | Free | Free | None | Linear | 25 | L | NA | Natural | Pleuronectes americanus | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 80 μg/ml | In vitro | None | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against P.aeruginosa, K.pneumoniae,S.aureus and C.albicans | 2000 | 10898673 |
| antitb_1361 | Pleurocidin | GWGSFFKKAAHVGKHVGKAALTHYL | Free | Free | None | Linear | 25 | L | NA | Natural | Pleuronectes americanus | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 20 μg/ml | In vitro | None | NA | NA | NA | NA | NA | NA | NA | 185 μM OF D-CYCLOSERINE DRUG + 5.2 μM OF Peptide reduces ~ 4 time MIC of drug | Antibacterial against P.aeruginosa, K.pneumoniae,S.aureus and C.albicans | 2000 | 10898673 |
| antitb_1371 | Mycobacterial tuberculosis DHFR tripeptide analog | WYD | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 1.26 × 10−7 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1372 | Mycobacterial tuberculosis DHFR tripeptide analog | WYE | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 5.02 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1373 | Mycobacterial tuberculosis DHFR tripeptide analog | WPD | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 9.12 × 10−9 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1374 | Mycobacterial tuberculosis DHFR tripeptide analog | WPE | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 1.02 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1375 | Mycobacterial tuberculosis DHFR tripeptide analog | YPD | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 4.17 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1376 | Mycobacterial tuberculosis DHFR tripeptide analog | YPE | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 2.75 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1377 | Mycobacterial tuberculosis DHFR tripeptide analog | WYY | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 1.78 × 10−9 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1378 | Mycobacterial tuberculosis DHFR tripeptide analog | WPY | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 9.55 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1379 | Mycobacterial tuberculosis DHFR tripeptide analog | WYP | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 4.57 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1380 | Mycobacterial tuberculosis DHFR tripeptide analog | WPW | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 4.27 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1381 | Mycobacterial tuberculosis DHFR tripeptide analog | WYW | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 1.45 × 10−7 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1382 | Mycobacterial tuberculosis DHFR tripeptide analog | WYS | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 1.44 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1383 | Mycobacterial tuberculosis DHFR tripeptide analog | WPS | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 7.94 × 10−8 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1384 | Mycobacterial tuberculosis DHFR tripeptide analog | WPT | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 2.95 × 10−7 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1385 | Mycobacterial tuberculosis DHFR tripeptide analog | WYT | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 3.31 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1386 | Mycobacterial tuberculosis DHFR tripeptide analog | YPS | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 8.91 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1387 | Mycobacterial tuberculosis DHFR tripeptide analog | YPT | Free | Free | None | Linear | 3 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis | Kd= 6.46 × 10−6 | in silico | NA | NA | NA | NA | NA | NA | NA | mycobacteium tuberculosis DHFR | NA | 2009 | 19697148 | |
| antitb_1389 | LL-37 | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml | in vitro | J774.A1 macrophage cell lines | 14% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1390 | LL-37 | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml (after 6 hours) | in vitro | J774.A1 macrophage cell lines | 34% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1391 | LL-37 | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg/ml | in vitro | J774.A1 macrophage cell lines | 41% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1392 | LL-37 | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg /ml (after 6 hours incubation) | in vitro | J774.A1 macrophage cell lines | 67% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1393 | GEK-31 | RKSKEKIGKEFKRIVQR IKDFLRNLVPRTES | Free | Free | None | Linear | 33 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | NA | in vitro | J774.A1 macrophage cell lines | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1394 | LL-18 | KEFKRIVQRIKDFLRNLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | NA | in vitro | J774.A1 macrophage cell lines | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1395 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml | in vitro | J774.A1 macrophage cell lines | 67% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1396 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 1μg /ml (after 6 hours) | in vitro | J774.A1 macrophage cell lines | 89% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1397 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg/ml | in vitro | J774.A1 macrophage cell lines | 81% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1398 | LLKKK-18 | KEFKRIVKRIKKFLRKLV | Free | Free | None | Linear | 19 | L | Cationic | Natural | Murine macrophages | Mycobacteria smegmatis | M. smegmatis mc2 155 | MIC = 25μg /ml (after 6 hours incubation) | in vitro | J774.A1 macrophage cell lines | 98% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1399 | LL-37 | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria bovis | Mycobacteria bovis BCG | MIC = 25μg/ml | in vitro | THP-1 cells | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |
| antitb_1400 | LL-37 | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES | Free | Free | None | Linear | 38 | L | Cationic | Natural | Murine macrophages | Mycobacteria bovis | Mycobacteria bovis BCG | MIC = 25μg /ml (after 624hours incubation) | in vitro | THP-1 cells | > 60% bacteria is cleared | NA | NA | NA | NA | NA | NA | NA | NA | 2011 | 21790937 |