Primary information |
---|
ID | antitb_1358 |
Peptide Name | Gran F1 |
Sequence | VSNAATRVCRTGRSRWRDVCRNFMRRYQSR |
N-terminal Modification | Free |
C-terminal Modification | Free |
Chemical Modification | None |
Linear/ Cyclic | Linear |
Length | 30 |
Chirality | L |
Nature | NA |
Source | Natural |
Origin | Human cytolytic lymphocytes |
Species | Mycobacterium tuberculosis |
Strain | Mycobacterium tuberculosis H37Rv ATCC 25622 |
Inhibition Concentartion | IC90 = 30 μM |
In vitro/In vivo | In vitro |
Cell Line | Human erythroleukaemia cell line K562 |
Inhibition Concentartion | NA |
Cytotoxicity | 34 % cytolytic activity in range of 3 -7 μM peptide concentration |
In vivo Model | NA |
Lethal Dose | NA |
Immune Response | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | NA |
Other Activities | Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus |
Pubmed ID | 10585872 |
Year of Publication | 1999 |
3-D Structure | View in Jmol or Download Structure |