Primary information |
---|
ID | antitb_1392 |
Peptide Name | LL-37 |
Sequence | [LL-37, 37 aa] |
N-terminal Modification | Free |
C-terminal Modification | Free |
Chemical Modification | None |
Linear/ Cyclic | Linear |
Length | 38 |
Chirality | L |
Nature | Cationic |
Source | Natural |
Origin | Murine macrophages |
Species | Mycobacteria smegmatis |
Strain | M. smegmatis mc2 155 |
Inhibition Concentartion | MIC = 25μg /ml (after 6 hours incubation) |
In vitro/In vivo | in vitro |
Cell Line | J774.A1 macrophage cell lines |
Inhibition Concentartion | 67% bacteria is cleared |
Cytotoxicity | NA |
In vivo Model | NA |
Lethal Dose | NA |
Immune Response | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | NA |
Other Activities | NA |
Pubmed ID | 21790937 |
Year of Publication | 2011 |
3-D Structure | View in Jmol or Download Structure |