| Primary information |
|---|
| ID | antitb_1389 |
| Peptide Name | LL-37 |
| Sequence | [LL-37, 37 aa] |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Length | 38 |
| Chirality | L |
| Nature | Cationic |
| Source | Natural |
| Origin | Murine macrophages |
| Species | Mycobacteria smegmatis |
| Strain | M. smegmatis mc2 155 |
| Inhibition Concentartion | MIC = 1μg /ml |
| In vitro/In vivo | in vitro |
| Cell Line | J774.A1 macrophage cell lines |
| Inhibition Concentartion | 14% bacteria is cleared |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Response | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | NA |
| Other Activities | NA |
| Pubmed ID | 21790937 |
| Year of Publication | 2011 |
| 3-D Structure |  View in Jmol or Download Structure |