Detailed description page of AntiTbPdb
| This page displays user query in tabular form. |
antitb_1399 details |
| Primary information | |
|---|---|
| ID | antitb_1399 |
| Peptide Name | LL-37 |
| Sequence | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Length | 38 |
| Chirality | L |
| Nature | Cationic |
| Source | Natural |
| Origin | Murine macrophages |
| Species | Mycobacteria bovis |
| Strain | Mycobacteria bovis BCG |
| Inhibition Concentartion | MIC = 25μg/ml |
| In vitro/In vivo | in vitro |
| Cell Line | THP-1 cells |
| Inhibition Concentartion | NA |
| Cytotoxicity | NA |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Response | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | NA |
| Other Activities | NA |
| Pubmed ID | 21790937 |
| Year of Publication | 2011 |
| 3-D Structure |  View in Jmol or Download Structure |