Primary information |
---|
ID | antitb_1358, |
Name | 10585872 |
N-Terminal modification | Gran F1 |
C-Terminal Modification | VSNAATRVCRTGRSRWRDVCRNFMRRYQSR |
Chemical Modification | Free |
Linear/Cyclic | Free |
Length | None |
Chirality | Linear |
Nature | 30 |
Source | L |
Species | Natural |
Strain | Human cytolytic lymphocytes |
Inhibition Concentration | Mycobacterium tuberculosis |
In Vitro/ In vivo | Mycobacterium tuberculosis H37Rv ATCC 25622 |
Cell Line | IC90 = 30 μM |
Inhibition Concentration | In vitro |
Sequence | 1999 |
Cytotoxicity | Human erythroleukaemia cell line K562 |
In vivo Model | NA |
Lethal Dose | 34 % cytolytic activity in range of 3 -7 μM peptide concentration |
Immune Responce | NA |
Mechanism of Action | NA |
Target | NA |
Combination Therapy | NA |
Other activities | NA |
PMID | NA |
Year of Publication | Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus |
Tertiary Structure (Technique) | Not Predicted), |