| Primary information |
|---|
| ID | antitb_1359 |
| Peptide Name | Granulysin |
| Sequence | TQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQG |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Length | 38 |
| Chirality | L |
| Nature | NA |
| Source | Natural |
| Origin | Human cytolytic lymphocytes |
| Species | Mycobacterium tuberculosis |
| Strain | Mycobacterium tuberculosis H37Rv ATCC 25623 |
| Inhibition Concentartion | IC90 = 30 μM |
| In vitro/In vivo | In vitro |
| Cell Line | Human erythroleukaemia cell line K562 |
| Inhibition Concentartion | NA |
| Cytotoxicity | 35 % cytolytic activity in range of 3 -7 μM peptide concentration |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Response | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | NA |
| Other Activities | Antibacterial against bacillus megaterium, E.coli, P.aeuroginosaand S.aureus |
| Pubmed ID | 10585872 |
| Year of Publication | 1999 |
| 3-D Structure |  View in Jmol or Download Structure |