Primary information |
---|
ID | antitb_1263 |
Peptide Name | RN7 (1-45) |
Sequence | KPKGMTSSQWFKIQHMQPSPQASNSAMKNINKHTKRSKDLNTFLH |
N-terminal Modification | Free |
C-terminal Modification | Free |
Chemical Modification | None |
Linear/ Cyclic | Linear |
Length | 45 |
Chirality | L |
Nature | Cationic |
Source | Protein Derived |
Origin | From the N terminus of RNase 8 |
Species | Mycobacterium vaccae |
Strain | Mycobacterium vaccae strain (ATCC 15483) |
Inhibition Concentartion | IC50 = 9.5 ± 0.3 μM |
In vitro/In vivo | In vitro |
Cell Line | None |
Inhibition Concentartion | NA |
Cytotoxicity | NA |
In vivo Model | None |
Lethal Dose | NA |
Immune Response | NA |
Mechanism of Action | Membrane depolarization and permeabilization |
Target | Cell envelope |
Combination Therapy | None |
Other Activities | Antibacterial and Antiparasitic |
Pubmed ID | 23716047 |
Year of Publication | 2013 |
3-D Structure | View in Jmol or Download Structure |