| Primary information |
|---|
| ID | antitb_1262, |
| Name | 23716047 |
| N-Terminal modification | RN7 (1-45) |
| C-Terminal Modification | KPKGMTSSQWFKIQHMQPSPQASNSAMKNINKHTKRSKDLNTFLH |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | None |
| Chirality | Linear |
| Nature | 45 |
| Source | L |
| Origin | Cationic |
| Species | Protein Derived |
| Strain | From the N terminus of RNase 7 |
| Inhibition Concentration | Mycobacterium vaccae |
| In Vitro/ In vivo | Mycobacterium vaccae strain (ATCC 15483) |
| Cell Line | MIC = 20.0 ± 0.8 μM |
| Inhibition Concentration | In vitro |
| Sequence | 2013 |
| Cytotoxicity | None |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | None |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Membrane depolarization and permeabilization |
| Other activities | Cell envelope |
| PMID | None |
| Year of Publication | Antibacterial and Antiparasitic |
Tertiary Structure
(Technique) | Not Predicted), |
| Primary information |
|---|
| ID | antitb_1263, |
| Name | 23716047 |
| N-Terminal modification | RN7 (1-45) |
| C-Terminal Modification | KPKGMTSSQWFKIQHMQPSPQASNSAMKNINKHTKRSKDLNTFLH |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | None |
| Chirality | Linear |
| Nature | 45 |
| Source | L |
| Origin | Cationic |
| Species | Protein Derived |
| Strain | From the N terminus of RNase 8 |
| Inhibition Concentration | Mycobacterium vaccae |
| In Vitro/ In vivo | Mycobacterium vaccae strain (ATCC 15483) |
| Cell Line | IC50 = 9.5 ± 0.3 μM |
| Inhibition Concentration | In vitro |
| Sequence | 2013 |
| Cytotoxicity | None |
| In vivo Model | NA |
| Lethal Dose | NA |
| Immune Responce | None |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | Membrane depolarization and permeabilization |
| Other activities | Cell envelope |
| PMID | None |
| Year of Publication | Antibacterial and Antiparasitic |
Tertiary Structure
(Technique) | Not Predicted), |