| Primary information |
|---|
| ID | antitb_1262 |
| Peptide Name | RN7 (1-45) |
| Sequence | KPKGMTSSQWFKIQHMQPSPQASNSAMKNINKHTKRSKDLNTFLH |
| N-terminal Modification | Free |
| C-terminal Modification | Free |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Length | 45 |
| Chirality | L |
| Nature | Cationic |
| Source | Protein Derived |
| Origin | From the N terminus of RNase 7 |
| Species | Mycobacterium vaccae |
| Strain | Mycobacterium vaccae strain (ATCC 15483) |
| Inhibition Concentartion | MIC = 20.0 ± 0.8 μM |
| In vitro/In vivo | In vitro |
| Cell Line | None |
| Inhibition Concentartion | NA |
| Cytotoxicity | NA |
| In vivo Model | None |
| Lethal Dose | NA |
| Immune Response | NA |
| Mechanism of Action | Membrane depolarization and permeabilization |
| Target | Cell envelope |
| Combination Therapy | None |
| Other Activities | Antibacterial and Antiparasitic |
| Pubmed ID | 23716047 |
| Year of Publication | 2013 |
| 3-D Structure |  View in Jmol or Download Structure |