Browse result page of AntiTbPdb
The total number entries retrieved from this search are 619
ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
antitb_1614 | RY-11 | RRRRRRRKDVY | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
antitb_1615 | RY-11 | RRRRRRRKDVY | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | RR-11 Peptide(31.25 mg/L) + Rifampicin (1.95mg/L) | NA | 2014 | 24411680 |
antitb_1616 | LK | LLKKLLKK | Free | Amidation | None | Linear | 8 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 125 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
antitb_1617 | PP | PLLKKLLKKP | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 250 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
antitb_1618 | CC | CLLKKLLKKC | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 250 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
antitb_1619 | II | ILLKKLLKKI | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 62.5 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
antitb_1620 | MM | MLLKKLLKKM | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 62.5 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
antitb_1621 | WW | WLLKKLLKKW | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 62.5 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2015 | 26380930 |
antitb_1622 | LK | LLKKLLKK | Free | Amidation | None | Linear | 8 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 62.5 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |
antitb_1623 | PP | PLLKKLLKKP | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 125 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |
antitb_1624 | CC | CLLKKLLKKC | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 250 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |
antitb_1625 | II | ILLKKLLKKI | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 15.6 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |
antitb_1626 | MM | MLLKKLLKKM | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 15.6 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | HC50= >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |
antitb_1627 | WW | WLLKKLLKKW | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC14468 | MIC = 0.98 μg/ml | in vitro | RAW 264.7 mouse macrophage | NA | >500 μg/ml | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide + Rifampicin (0.98 μg/ml) | NA | 2015 | 26380930 |
antitb_1628 | LL-37 | [LL-37, 37 aa] | Free | Free | None | Linear | 37 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacteria smegmatis mc2 155 | MIC = 2400 μg/ml | in vitro | J774 macrophage cell lines | NA | IC50= 11226 μg/ml | NA | NA | Stimulation of TNF-α production | inhibit bacterial Atpase activity | NA | NA | NA | 2015 | 26218806 |
antitb_1629 | LLAP | RKSAKKIGKRAKR | Free | Free | None | Linear | 13 | L | Cationic | Natural | NA | Mycobacterium smegmatis | Mycobacteria smegmatis mc2 155 | MIC = 600 μg/ml | in vitro | J774 macrophage cell lines | NA | IC50= 11226 μg/ml | NA | NA | Stimulation of TNF-α production | inhibit bacterial Atpase activity | NA | NA | NA | 2015 | 26218806 |
antitb_1630 | Callyaerins 6 | I-(Hyp)-VILPPLPIFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 12 | D | Cationic | Natural | Derived from Callyspongia aerizusa | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv | IC90= 2 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
antitb_1631 | Callyaerins 6 | I-(Hyp)-VILPPLPIFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 12 | D | Cationic | Natural | Derived from Callyspongia aerizusa | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv | MIC= 6 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
antitb_1632 | Callyaerins 6 | I-(Hyp)-VILPPLPIFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 12 | D | Cationic | Natural | Derived from Callyspongia aerizusa | NA | in vitro on THP1 cell line | IC50= 30 μg/ml | in vitro | THP-1 cell line | 50% reduction in bacterial load | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
antitb_1633 | Callyaerins 6 | I-(Hyp)-VILPPLPIFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 12 | D | Cationic | Natural | Derived from Callyspongia aerizusa | NA | in vitro on THP1 cell line | IC90= 50 μg/ml | in vitro | THP-1 cell line | 90% reduction in bacterial load | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
antitb_1634 | Callyaerins 6 | I-(Hyp)-VILPPLPIFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 12 | D | Cationic | Natural | Derived from Callyspongia aerizusa | NA | in vitro on MRC-5 cell lines | IC50= 20 μg/ml | in vitro | MRC-5 cell lines | 50% reduction in bacterial load | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
antitb_1635 | Callyaerins 6 | I-(Hyp)-VILPPLPIFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 12 | D | Cationic | Natural | Derived from Callyspongia aerizusa | NA | in vitro on MRC-5 cell lines | IC90 = 40 μg/ml | in vitro | MRC-5 cell lines | 90% reduction in bacterial load | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
antitb_1636 | Callyaerins 7 | I-(Hyp)-VILPPLPIFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 11 | D | Cationic | Natural | Derived from Callyspongia aerizusa | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv | IC90 =5 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
antitb_1637 | Callyaerins 7 | I-(Hyp)-VILPPLPIFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 11 | D | Cationic | Natural | Derived from Callyspongia aerizusa | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 10 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
antitb_1638 | Callyaerins 7 | I-(Hyp)-VILPPLPIFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 11 | D | Cationic | Natural | Derived from Callyspongia aerizusa | NA | NA | IC50= 5 μg/ml | in vitro | THP-1 cell line | 50% reduction in bacterial load | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
antitb_1639 | Callyaerins 7 | I-(Hyp)-VILPPLPIFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 11 | D | Cationic | Natural | Derived from Callyspongia aerizusa | NA | NA | IC90 = 30μg/ml | in vitro | THP-1 cell line | 90% reduction in bacterial load | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
antitb_1640 | Callyaerins 7 | I-(Hyp)-VILPPLPIFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 11 | D | Cationic | Natural | Derived from Callyspongia aerizusa | NA | NA | IC50= 2 μg/ml | in vitro | MRC-5 cell lines | 50% reduction in bacterial load | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
antitb_1641 | Callyaerins 7 | I-(Hyp)-VILPPLPIFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 11 | D | Cationic | Natural | Derived from Callyspongia aerizusa | NA | NA | I90C = 6 μg/ml | in vitro | MRC-5 cell lines | 90% reduction in bacterial load | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
antitb_1642 | Callyaerins 8 | H-(Hyp)-LLPPVPLFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 11 | D | Cationic | Natural | Derived from Callyspongia aerizusa | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv | IC90= 40 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
antitb_1643 | Callyaerins 8 | H-(Hyp)-LLPPVPLFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 11 | D | Cationic | Natural | Derived from Callyspongia aerizusa | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 100 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
antitb_1644 | Callyaerins 8 | H-(Hyp)-LLPPVPLFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 11 | D | Cationic | Natural | Derived from Callyspongia aerizusa | NA | NA | IC50= >100 μg/ml | in vitro | THP-1 cell line | 50% reduction in bacterial load | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
antitb_1645 | Callyaerins 8 | H-(Hyp)-LLPPVPLFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 11 | D | Cationic | Natural | Derived from Callyspongia aerizusa | NA | NA | IC90 = >100 μg/ml | in vitro | THP-1 cell line | 90% reduction in bacterial load | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
antitb_1646 | Callyaerins 8 | H-(Hyp)-LLPPVPLFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 11 | D | Cationic | Natural | Derived from Callyspongia aerizusa | NA | NA | IC50= >100 μg/ml | in vitro | MRC-5 cell lines | 50% reduction in bacterial load | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
antitb_1647 | Callyaerins 8 | H-(Hyp)-LLPPVPLFG | Free | Amidation | Hyp= Hydroxiproline, Residue 1-8 involved in cyclic bond formation | Cyclic | 11 | D | Cationic | Natural | Derived from Callyspongia aerizusa | NA | NA | IC90 = 100 μg/ml | in vitro | MRC-5 cell lines | 90% reduction in bacterial load | NA | NA | NA | NA | NA | NA | NA | NA | 2015 | 26213786 |
antitb_1648 | Tuftsin peptide conjugate compound | EFAGAGFVRAGAL | INH is conjugated | Free | None | Cyclic | 13 | L | Cationic | Natural | Derived from 16-kDa protein of M. tuberculosis and tuftsin-derived peptides | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv ATCC 27294 | MIC = 2.52 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Cell wall biosynthesis inhibition | NA | Peptide + INH(0.24 ug/ml) | NA | 2009 | 19319854 |
antitb_1649 | Tuftsin peptide conjugate compound | SEFAYGSFVRTVSLPV | INH is conjugated | Free | None | Cyclic | 16 | L | Cationic | Natural | Derived from 16-kDa protein of M. tuberculosis and tuftsin-derived peptides | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv ATCC 27294 | MIC = 2.54 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Cell wall biosynthesis inhibition | NA | Peptide + INH(0.24 ug/ml) | NA | 2009 | 19319854 |
antitb_1650 | Tuftsin peptide conjugate compound | SEFAYGSFVRTVSLPV | INH is conjugated | Free | None | Cyclic | 16 | L | Cationic | Natural | Derived from 16-kDa protein of M. tuberculosis and tuftsin-derived peptides | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv ATCC 27294 | MIC = 2.26μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Cell wall biosynthesis inhibition | NA | Peptide + INH(0.24 ug/ml) | NA | 2009 | 19319854 |
antitb_1651 | Human neutrohil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Synthetic | Human neutrophil | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv | IC50 = 0.8μg/ml | in vitro | murine macrophage-like cell line J744A.1 | NA | cytotoxic at above concentration 5 ug/ml | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 2016 | 10933095 |
antitb_1652 | Human neutrohil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Synthetic | Human neutrophil | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv | IC90 = 2.5 μg/ml | in vitro | murine macrophage-like cell line J744A.1 | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 2016 | 10933095 |
antitb_1653 | NA | WKWLKKWIK | Free | Free | None | Linear | 9 | L | Cationic | Synthetic | NA | Mycobacterium Tuberculosis | Mycobacterium tuberculosis H37Rv | IC90 = 1.5 μg/ml | in vitro | Human THP-1 cell lines | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 2016 | 26645944 |
antitb_1672 | Lariatin A | GSQLVYRWVGHSNVIKGP | Free | Free | Alpha carbon of glutamine form amide bond with first glycine and gamma carbon of glutamine involved in side chain formation | Cyclic | 18 | D | Cationic | Natural | Rhodococcus jostii B0171 | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC607 | MIC = 10 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2007 | 17617692 |
antitb_1673 | Lariatin B | GSQLVYRWVGHSNVIKGP | Free | Free | Alpha carbon of glutamine form amide bond with first glycine and gamma carbon of glutamine involved in side chain formation | Cyclic | 18 | NA | Cationic | Natural | Rhodococcus jostii B0171 | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC607 | MIC = 10 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | NA | 2007 | 17617692 |
antitb_1674 | Wollamides 2 | WLL-allo-ING | NA | NA | Fourth amino acid is allolysine and form cyclic structure with 1st and 6th | Cyclic | 6 | D | Cationic | Natural | Streptomyces species MST-115088 | Mycobacterium bovis | Mycobacterium bovis BCG | NA | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against staphylococcus aureus and bacillus subtilis | 2014 | 25229313 |
antitb_1675 | Wollamides 5 | WLLVNG | Free | Free | NA | Cyclic | 6 | D | Cationic | Natural | Streptomyces species MST-115088 | Mycobacterium bovis | Mycobacterium bovis BCG | IC50 = 2.8 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against staphylococcus aureus and bacillus subtilis | 2014 | 25229313 |
antitb_1676 | Wollamides 6 | WLV-allo-ING | Free | Free | Fourth amino acid is allolysine and form cyclic structure with 1st and 6th | Cyclic | 6 | D | Cationic | Natural | Streptomyces species MST-115088 | Mycobacterium bovis | Mycobacterium bovis BCG | IC50 = 3.1 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against staphylococcus aureus and bacillus subtilis | 2014 | 25229313 |
antitb_1677 | Globomycin | not available | NA | NA | NA | Cyclic | 0 | D | Cationic | Natural | Derived from streptomyces halstedii 13912 | Mycobacterium smegmatis | Mycobacterium smegmatis ATCC607 | MIC = >100 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | NA | NA | NA | Antibacterial against bacillus sub!ills , E.coli, S.aureus Antifungal against Aspergillus oryzae SANK 11262, Candida albicans | 1977 | 353012 |
antitb_1702 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys29 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis Ra 7632G | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
antitb_1703 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys30 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis Ra 9034G | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
antitb_1704 | Human neutrophil peptide (HNP-1) | ACYCRIPACIAGERRYGTCIYQGRLWAFCC | Free | Free | Disulphide linkage between cys2-cys30, cys4-cys19,cys9-cys31 | Cyclic | 30 | L | Cationic | Natural | Human neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis Ra 11170G | Reduction in CFU at 50 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |
antitb_1705 | Synthetic rabbit neytrophil (SNP-1) | not available | NA | NA | NA | NA | 0 | NA | Cationic | Natural | Rabbit neutrophil | Mycobacterium tuberculosis | Mycobacterium tuberculosis Ra 7632G | 5Reduction in CFU at 0 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Microbial membrane disruption | NA | NA | NA | 1996 | 8641802 |