Browse result page of AntiTbPdb
The total number entries retrieved from this search are 619
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1876 | Dhvar4 | KRLFKKLLFSLRKY | Free | Free | None | Linear | 14 | L | Cationic | Protein Derived | Human salivary Histatin derivative | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 27294) | MIC >300 μM | In vitro | RBC | NA | 50% hemolysis at >300 μM | NA | NA | NA | NA | NA | NA | Antibacterial (Streptococcus pneumoniae) | 2017 | 28314993 |
| antitb_1877 | Crot(1–9,38–42) | YKQCHKKGGKKGSG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Crotamine, a toxin of Crotalus durissus terrificus | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 27294) | MIC >300 μM | In vitro | RBC | NA | 50% hemolysis at >300 μM | NA | NA | NA | NA | NA | NA | Antibacterial (Streptococcus pneumoniae) | 2017 | 28314993 |
| antitb_1878 | CM15 | KWKLFKKIGAVLKVL | Free | Free | None | Linear | 15 | L | Cationic | Synthetic | From Cecropin A and Melittin sequences | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 27294) | MIC >300 μM | In vitro | RBC | NA | 50% hemolysis at 18.9 ± 1.71 μM | NA | NA | NA | NA | NA | NA | Antibacterial (Streptococcus pneumoniae) | 2017 | 28314993 |
| antitb_1879 | Melittin | GIGAVLKVLTTGLPALISWIKRKRQQ | Free | Free | None | Linear | 26 | L | Cationic | Natural | Venom of Apis mellifera | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 27294) | MIC >300 μM | In vitro | RBC | NA | 50% hemolysis at 0.339 ± 0.0854 μM | NA | NA | NA | NA | NA | NA | Antibacterial (Streptococcus pneumoniae) | 2017 | 28314993 |
| antitb_1880 | OT20 | TKPKGTKPKGTKPKGTKPKG | Free | Free | None | Linear | 20 | L | Cationic | Synthetic | Tetramer derivative of tuftsin sequence | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv (ATCC 27294) | MIC >300 μM | In vitro | RBC | NA | 50% hemolysis at >300 μM | NA | NA | NA | NA | NA | NA | Antibacterial (Streptococcus pneumoniae) | 2017 | 28314993 |
| antitb_1893 | Human lactoferricin 1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Natural | Derived from human lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2447 smT | IC50 = 15.8 ± 4.5 μM | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1894 | Human lactoferricin 1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Natural | Derived from human lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2447 smT | IC90 = 34.6 ± 22.4 μM | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1895 | Human lactoferricin 1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Natural | Derived from human lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smT | IC50 = 11.0 ± 4.1 μM | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1896 | Human lactoferricin 1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Natural | Derived from human lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smT | IC90 = 65.8 ± 19.13 μM | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1897 | Human lactoferricin 1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Natural | Derived from human lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smD | IC50 = 15.2± 2.9 μM | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1898 | Human lactoferricin 1-11 | GRRRRSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Natural | Derived from human lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smD | IC90 = 37.9 ± 15.9 μM | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1899 | Human lactoferricin 1-11 | GKKKKSVQWCA | Free | Free | None | Linear | 11 | L | Cationic | Natural | Derived from human lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1900 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2447 smT | IC50 = 14.2 ± 1.5 μM | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1901 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2447 smT | IC90 = 18.9 ± 4.0 μM | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1902 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smT | IC50 = 8.0 ± 1.5 μM | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1903 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smT | IC90 = 22.8 ± 9.1 μM | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1904 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smD | IC50 = 12.4± 0.3 μM | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1905 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium 2-151 smD | IC90 = 21.5± 4.0 μM | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1906 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | D | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1907 | Bovine lactoferricin 17-30 | FKCRRWQWRMKKLG | Free | Free | None | Linear | 14 | D | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1908 | Bovine lactoferricin 17-30 all K | FKCKKWQWKMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1909 | Bovine lactoferricin 17-30 all K | FKCKKWQWKMKKLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1910 | Bovine lactoferricin 17-30 all R | FRCRRWQWRMRRLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 50% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1911 | Bovine lactoferricin 17-30 all R | FRCRRWQWRMRRLG | Free | Free | None | Linear | 14 | L | Cationic | Natural | Derived from bovine lactoferricin protein | Mycobacterium avium | Mycobacterium avium | Mycobacterium avium 2447 smT | In vitro | NA | Tratment with this concentration inhibit 90% bacterial growth | NA | NA | NA | NA | NA | Lipid bilayer | NA | NA | 2014 | 24709266 |
| antitb_1912 | None | ILSLRWRWKWWKK | Free | Free | None | Linear | 13 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis | MIC = 8 μM | In vitro | J774.16 mouse macrophages and A549 human lung epithelial cells | NA | No cytotoxicity against J774.16 mouse macrophages and A549 human lung epithelial cells | NA | NA | NA | NA | Lipid bilayer | NA | Antibacterial against Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus pneumoniae ATCC 49619, Klebsiella pneumoniae, Pseudomonas aeruginosa ATCC27853, Bacillus subtilis BGSC 1A1. | 2016 | 26902758 |
| antitb_1913 | None | ILSLRWRWKWWKK | Free | Free | None | Linear | 13 | L | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis mc2 6020 | MIC = 32 μM | In vitro | J774.16 mouse macrophages and A549 human lung epithelial cells | NA | No cytotoxicity against J774.16 mouse macrophages and A549 human lung epithelial cells | NA | NA | NA | NA | Lipid bilayer | NA | Antibacterial against Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus pneumoniae ATCC 49619, Klebsiella pneumoniae, Pseudomonas aeruginosa ATCC 27853, Bacillus subtilis BGSC 1A1. | 2016 | 26902758 |
| antitb_1914 | None | ILSLRWRWKWWKK | Free | Free | None | Linear | 13 | L | Cationic | Synthetic | NA | Mycobacterium bovis | Mycobacterium bovis BCG pasteur strain | MIC = 32 μM | In vitro | J774.16 mouse macrophages and A549 human lung epithelial cells | NA | No cytotoxicity against J774.16 mouse macrophages and A549 human lung epithelial cells | NA | NA | NA | NA | Lipid bilayer | NA | Antibacterial against Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus pneumoniae ATCC 49619, Klebsiella pneumoniae, Pseudomonas aeruginosa ATCC 27853, Bacillus subtilis BGSC 1A1. | 2016 | 26902758 |
| antitb_1915 | Laterosporulin 10 | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEWGGPCQL | Free | Free | Disulphide bond between residues 2-43, 6-35 and 20-51 | Cyclic | 53 | D | Cationic | Natural | Derived from Brevibacillus species SKDU10 | Mycobacterium smegmatis | Mycobacterium smegmatis MC2 155 | MIC = 45 μM | In vitro and ex vivo | RAW 264.7 murine macrophage | NA | No cytotoxicity upto 40 μM/ml concentration | NA | NA | NA | NA | Cell wall pore formation | 0.00625 μM of rifampicin with 0.25 μM of peptide, a fourfold reduction in MIC of rifampicin against H37 RV | Antibacterial against Staphylococcus aureus MTCC 1430, Bacillus subtilis MTCC 121, Pseudomonas aeruginosa MTCC 1934, Vibrio cholerae MTCC 3904, Escherichia coli MTCC 1610 | 2016 | 27267959 |
| antitb_1916 | Peptide-1 | GF(A6c)G(A6c)KK(A6c)G(A6c)F(A6c)G(A6c)GKK(A6c)KKKK | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, | Linear | 22 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC =4.92 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1917 | Peptide-2 | GF(A6c)G(A6c)R(A6c)G(A6c)F(A6c)G(A6c)GR(A6c)RRRR | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, | Linear | 19 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 40.75 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1918 | Peptide-3 | GF(A6c)G(A6c)Orn(A6c)G(A6c)F(A6c)G(A6c)GOrn(A6c)Orn-Orn- Orn- Orn | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, orn = ornithine | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 11.37 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1919 | Peptide-4 | GF(A6c)G(A6c)Dab(A6c)G(A6c)F(A6c)G(A6c)GDab(A6c)Dab-Dab-Dab-Dab | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, Dab = 2,4-diaminobutyric acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC =11.83 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1920 | Peptide-5 | GF(A6c)G(A6c)Dpr(A6c)G(A6c)F(A6c)G(A6c)GDpr(A6c) Dpr-Dpr-Dpr- Dpr | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, Dpr = 2,4-diaminopropanoic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 24.63 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1921 | Peptide-6 | GF(A5c)G(A5c)K(A5c)G(A5c)F(A5c)G(A5c)GK(A5c)KKKK | Acetylation | Amidation | A5c = 1-aminocyclopentane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 11.42 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1922 | Peptide-7 | GF(A5c)G(A5c)R(A5c)G(A5c)F(A5c)G(A5c)GR(A5c)RRRR | Acetylation | Amidation | A5c = 1-aminocyclopentane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC =21.22 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1923 | Peptide-8 | GF(A6c)G(Tic)K(A6c)G(Tic)F(A6c)G(Tic)GK(Tic)KKKK | Acetylation | Amidation | Tic = Tetrahydroisoquinolinecarboxylic acid, A6c 1-aminocyclohexane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 10.33 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1924 | Peptide-9 | GF(A6c)G(Oic)K(A6c)G(Oic)F(A6c)G(Oic)GK(Oic)KKKK | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, Oic = Octahydroindolecarboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 20.92 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1925 | Peptide-10 | GF(A5c)G(A6c)K(A5c)G(A6c)F(A5c)G(A6c)GK(A5c)KKKK | Acetylation | Amidation | A5c = 1-aminocyclopentane carboxylic acid, A6c 1-aminocyclohexane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 22.42 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1926 | Peptide-11 | KKKKGF(A6c)G(A6c)K(A6c)G(A6c)F(A6c)G(A6c)GK(A6c) | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | MIC = 21.87 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1927 | Peptide-1 | GF(A6c)G(A6c)KK(A6c)G(A6c)F(A6c)G(A6c)GKK(A6c)KKKK | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, | Linear | 22 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC =4.92 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1928 | Peptide-2 | GF(A6c)G(A6c)R(A6c)G(A6c)F(A6c)G(A6c)GR(A6c)RRRR | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, | Linear | 19 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC = 40.75 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1929 | Peptide-3 | GF(A6c)G(A6c)Orn(A6c)G(A6c)F(A6c)G(A6c)GOrn(A6c)Orn-Orn- Orn- Orn | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, orn = ornithine | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC = 11.37 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1930 | Peptide-4 | GF(A6c)G(A6c)Dab(A6c)G(A6c)F(A6c)G(A6c)GDab(A6c)Dab-Dab-Dab-Dab | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, Dab = 2,4-diaminobutyric acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC =25.65 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1931 | Peptide-5 | GF(A6c)G(A6c)Dpr(A6c)G(A6c)F(A6c)G(A6c)GDpr(A6c) Dpr-Dpr-Dpr- Dpr | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, Dpr = 2,4-diaminopropanoic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC = 49.26 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1932 | Peptide-6 | GF(A5c)G(A5c)K(A5c)G(A5c)F(A5c)G(A5c)GK(A5c)KKKK | Acetylation | Amidation | A5c = 1-aminocyclopentane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC = 22.85 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1933 | Peptide-7 | GF(A5c)G(A5c)R(A5c)G(A5c)F(A5c)G(A5c)GR(A5c)RRRR | Acetylation | Amidation | A5c = 1-aminocyclopentane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC >43 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1934 | Peptide-8 | GF(A6c)G(Tic)K(A6c)G(Tic)F(A6c)G(Tic)GK(Tic)KKKK | Acetylation | Amidation | Tic = Tetrahydroisoquinolinecarboxylic acid, A6c 1-aminocyclohexane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC = 20.6μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1935 | Peptide-9 | GF(A6c)G(Oic)K(A6c)G(Oic)F(A6c)G(Oic)GK(Oic)KKKK | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, Oic = Octahydroindolecarboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC = 20.92 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1936 | Peptide-10 | GF(A5c)G(A6c)K(A5c)G(A6c)F(A5c)G(A6c)GK(A5c)KKKK | Acetylation | Amidation | A5c = 1-aminocyclopentane carboxylic acid, A6c 1-aminocyclohexane carboxylic acid | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC = 11.21 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |
| antitb_1937 | Peptide-11 | KKKKGF(A6c)G(A6c)K(A6c)G(A6c)F(A6c)G(A6c)GK(A6c) | Acetylation | Amidation | A6c = 1-aminocyclohexane carboxylic acid, | Linear | 20 | D | Cationic | Synthetic | NA | Mycobacterium tuberculosis | Mycobacterium tuberculosis MDR | MIC = 5.47 μM | In vitro | NA | NA | NA | NA | NA | NA | NA | Cell wall pore formation | NA | Antibacterial against Enterobacter aerogenes, Acinetobacter baumannii, Psuedomonas aeruginosa, Klebsiella pneumoniae, Eenterococcus faecalis, Staphylococcus aureus | 2016 | 27387357 |