Browse result page of AntiTbPdb
The total number entries retrieved from this search are 619
| ID | Name | Sequence | N-Terminal Modification | C-Terminal Modification | Chemical Modification | Linear/Cyclic | Length | Chirality | Nature | Source | Origin | Species | Strain | Inhibition Concentration | In vitro/ In vivo | Cell Line | Intracellular Inhibition | Cytotoxicity | Animal Model | Effective Dose in model organism | Immune Responce | Mechanism of Action | Target | Combination Therapy | Other Activities | Year of Publication | Pubmed ID/ Patent No. |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| antitb_1564 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 2.70 ± 0.15 at peptide concentration 64μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1565 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 0.88± 0.30 at peptide concentration 4 μg/ml +INH 0.06 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | INH +peptide | NA | 2004 | 15245864 |
| antitb_1566 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.19 ± 0.15 at peptide concentration 64 μg/ml +INH 0.06 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | INH+Peptide | NA | 2004 | 15245864 |
| antitb_1567 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.19 ± 0.15 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1568 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.58 ± 0.47 at peptide concentration 8 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1569 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.16 ± 0.21 at peptide concentration 16 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1570 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 2.97 ± 0.40 at peptide concentration 32 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1571 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 2.70 ± 0.10 at peptide concentration 64 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1572 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 1.72 ± 0.46 at peptide concentration 128 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1573 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 3.08 ± 0.09 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1574 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 19 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM23 | CFU/well 2.97 ± 0.06 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1575 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 20 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM24 | CFU/well 3.11 ± 0.09 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1576 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 21 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM25 | CFU/well 3.19 ± 0.05 at peptide concentration 4 μg/ml +INH 4μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1577 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 22 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM26 | CFU/well 3.08 ± 0.09 at peptide concentration 64 μg/ml +INH 4μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1578 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 3.10 ± 0.08 at peptide concentration 8 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1579 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 3.00 ± 0.10 at peptide concentration 16 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1580 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 3.05 ± 0.11 at peptide concentration 32 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1581 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.88 ± 0.06at peptide concentration 64 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1582 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.71 ± 0.09 at peptide concentration 128 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1583 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.11 ± 0.10 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1584 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.15 ± 0.0.16 at peptide concentration 64 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1585 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 1.31 ± 0.10 at peptide concentration 4 μg/ml + INH 0.06 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | peptide +INH | NA | 2004 | 15245864 |
| antitb_1586 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | peptide +INH | NA | 2004 | 15245864 |
| antitb_1587 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.15 ± 0.20 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1588 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.21 ± 0.42 at peptide concentration 8 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1589 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 3.02 ± 0.30 at peptide concentration 16 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1590 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 2.991± 0.23 at peptide concentration 32 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1591 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 2.90± 0.20 at peptide concentration 64 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1592 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 2.80 ± 0.15 at peptide concentration 128 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1593 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.91 ± 0.19 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1594 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.89 ± 0.19 at peptide concentration 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1595 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.70 ± 0.15 at peptide concentration 64 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1596 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.90 ± 0.09 at peptide concentration 4 μg/ml + INH 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1597 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.91 ± 0.19 at peptide concentration 64 μg/ml + INH 4 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1598 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.93 ± 0.07 at peptide concentration 8 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | INH+peptide | NA | 2004 | 15245864 |
| antitb_1599 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.78 ± 0.15 at peptide concentration 16 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | INH+peptide | NA | 2004 | 15245864 |
| antitb_1600 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.80 ± 0.14 at peptide concentration 32 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1601 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.66 ± 0.15 at peptide concentration 64 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1602 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 2.60 ± 0.17 at peptide concentration 128 μg/ml | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | NA | NA | 2004 | 15245864 |
| antitb_1603 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-13 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | CFU/well 0.68 ± 0.30 at peptide 64ul + 4 ul of INH | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide(64 ul) + INH(4 ul) | NA | 2004 | 15245864 |
| antitb_1604 | Protegrin -1 | RGGRLCYCRRRFCVCVGR | Free | Free | Disulphide linkage 6-15 and 8-14 | Cyclic | 18 | L | Cationic | Natural | Derived from porcine leucocyte | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 1.99 ± 0.44 at peptide 64ul + 4 ul of INH | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide(64 ul) + INH(4 ul) | NA | 2004 | 15245864 |
| antitb_1605 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis H37Rv | NA | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide(64 ul) + INH(4 ul) | NA | 2004 | 15245864 |
| antitb_1606 | β-Defensin-1(HBD-1) | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | Free | Free | Disulphide nlinkage between cys5-34, cys12-27, cys17-35. | Cyclic | 36 | L | Cationic | Natural | Derived from beta defensin 1 OF HUMAN | Mycobacterium tuberculosis | Mycobacterium tuberculosis RM22 | CFU/well 0.90 ± 0.75 at peptide 64ul + 4 ul of INH | in vitro | NA | NA | NA | NA | NA | NA | Bacterial membrane pore formation | NA | Peptide(64 ul) + INH(4 ul) | NA | 2004 | 15245864 |
| antitb_1607 | TP-5 | RKDVY | Free | Amidation | None | Linear | 4 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-susceptible | MIC = > 1000mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1608 | RR-6 | RRRRRR | Free | Amidation | None | Linear | 5 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-susceptible | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1609 | RR-11 | RKDVYRRRRRR | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-susceptible | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1610 | RY-11 | RRRRRRRKDVY | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-susceptible | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1611 | TP-5 | RKDVY | Free | Amidation | None | Linear | 4 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | NA | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1612 | RR-6 | RRRRRR | Free | Amidation | None | Linear | 5 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |
| antitb_1613 | RR-11 | RKDVYRRRRRR | Free | Amidation | None | Linear | 10 | L | Cationic | Synthetic | NA | Mycobacterium smegmatis | Mycobacterium smegmatis RIF-Resistance | MIC = 125 mg/L | in vitro | RAW 264.7 mouse macrophage | NA | HC50= > 2000 mg/L on Human RBC | NA | NA | Stimulate TNF-α production | Disrupt the mycobacterial membrane | NA | NA | NA | 2014 | 24411680 |