| Primary information |
|---|
| ID | antitb_1915, |
| Name | 27267959 |
| N-Terminal modification | Laterosporulin 10 |
| C-Terminal Modification | ACVNQCPDAIDRFIVKDKGCHGVEKKYYKQVYVACMNGQHLYCRTEWGGPCQL |
| Chemical Modification | Free |
| Linear/Cyclic | Free |
| Length | Disulphide bond between residues 2-43, 6-35 and 20-51 |
| Chirality | Cyclic |
| Nature | 53 |
| Source | D |
| Origin | Cationic |
| Species | Natural |
| Strain | Derived from Brevibacillus species SKDU10 |
| Inhibition Concentration | Mycobacterium smegmatis |
| In Vitro/ In vivo | Mycobacterium smegmatis MC2 155 |
| Cell Line | MIC = 45 μM |
| Inhibition Concentration | In vitro and ex vivo |
| Sequence | 2016 |
| Cytotoxicity | RAW 264.7 murine macrophage |
| In vivo Model | NA |
| Lethal Dose | No cytotoxicity upto 40 μM/ml concentration |
| Immune Responce | NA |
| Mechanism of Action | NA |
| Target | NA |
| Combination Therapy | NA |
| Other activities | Cell wall pore formation |
| PMID | 0.00625 μM of rifampicin with 0.25 μM of peptide, a fourfold reduction in MIC of rifampicin against H37 RV |
| Year of Publication | Antibacterial against Staphylococcus aureus MTCC 1430, Bacillus subtilis MTCC 121, Pseudomonas aeruginosa MTCC 1934, Vibrio cholerae MTCC 3904, Escherichia coli MTCC 1610 |
Tertiary Structure
(Technique) | Not Predicted), |