Browse result page of PRRDB 2.0

PRRID	Name of Ligand	Source of ligand	Sequence of Ligand	Length of Ligand	Type of Ligand	Occurence	Role of Ligand	Name of Receptor	Type of Reeptor	Source of the Receptor	Localization	Domain	Sequence of Receptor	Swiss prot ID	Length of receptor	Function of Receptor	Assay used	PMID	Year of publication	Pubchem assay
PRRID_0728	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	On binding to the receptor it leads to the release of an array of cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	P815 cells	NA	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	Immunostimulation and inflammation	NA	20798518	2010	Pubchem Assay
PRRID_0728	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	On binding to the receptor it leads to the release of an array of cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	P815 cells	NA	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	Immunostimulation and inflammation	NA	20798518	2010	Pubchem Assay
PRRID_0730	Peptidoglycan (PGN) Click for more detail	Gram-positive bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	Peptidoglycan is the potent activator of the TLR2	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	stage 3-4 CKD and HD patients	CD14+ Monocytes	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It has the role in the inflammation.	NA	20729266	2010	Pubchem Assay
PRRID_0730	Peptidoglycan (PGN) Click for more detail	Gram-positive bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	Peptidoglycan is the potent activator of the TLR2	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	stage 3-4 CKD and HD patients	CD14+ Monocytes	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It has the role in the inflammation.	NA	20729266	2010	Pubchem Assay
PRRID_0731	Peptidoglycan (PGN) Click for more detail	S. aureus (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	dendritic cells, macrophages and lymphocytes	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	NA	NA	20713100	2010	Pubchem Assay
PRRID_0731	Peptidoglycan (PGN) Click for more detail	S. aureus (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	dendritic cells, macrophages and lymphocytes	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	NA	NA	20713100	2010	Pubchem Assay
PRRID_0732	Peptidoglycan (PGN) Click for more detail	Gram-positive bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Microglia	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It boosted the ingestion of Alzheimer‚Äôs disease neurotoxic Amyloid Œ≤ (AŒ≤) protein in vitro	NA	20706642	2010	Pubchem Assay
PRRID_0732	Peptidoglycan (PGN) Click for more detail	Gram-positive bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Microglia	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It boosted the ingestion of Alzheimer‚Äôs disease neurotoxic Amyloid Œ≤ (AŒ≤) protein in vitro	NA	20706642	2010	Pubchem Assay
PRRID_0735	Peptidoglycan (PGN) Click for more detail	Gram-positive bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD88,/TIRAP and aloow the rerutiment of downstream effector	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Cell surface	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It leadsto the secretion of the proinfalmmatory cytokines	NA	20620129	2010	Pubchem Assay
PRRID_0735	Peptidoglycan (PGN) Click for more detail	Gram-positive bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD88,/TIRAP and aloow the rerutiment of downstream effector	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Cell surface	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It leadsto the secretion of the proinfalmmatory cytokines	NA	20620129	2010	Pubchem Assay
PRRID_0736	Peptidoglycan (PGN) Click for more detail	streptomyces species (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	It's binding induces the production of IL6, IL8, MMP3 and MMP1	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Fibroblast Like Synoviocytes (FLS)	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It has a role in the pathogenesis of juvenile idiopathic arthritis and cartilage destruction	ELISA	20571165	2010	Pubchem Assay
PRRID_0736	Peptidoglycan (PGN) Click for more detail	streptomyces species (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	It's binding induces the production of IL6, IL8, MMP3 and MMP1	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Fibroblast Like Synoviocytes (FLS)	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It has a role in the pathogenesis of juvenile idiopathic arthritis and cartilage destruction	ELISA	20571165	2010	Pubchem Assay
PRRID_0737	Peptidoglycan (PGN) Click for more detail	S. aureus (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	PGN induced iNOS, COX-2 and proinflammatory cytokine expression was mediated through the TLR2/MyD88/PI3-kinase/AKT pathway, which in turn initiates IKKŒ±/Œ≤ and NF-Œ∫B.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	Microglial cells	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It enhances proinflammatory cytokine expression	Transfection and reporter gene assay	20451669	2010	Pubchem Assay
PRRID_0737	Peptidoglycan (PGN) Click for more detail	S. aureus (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	PGN induced iNOS, COX-2 and proinflammatory cytokine expression was mediated through the TLR2/MyD88/PI3-kinase/AKT pathway, which in turn initiates IKKŒ±/Œ≤ and NF-Œ∫B.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	Microglial cells	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It enhances proinflammatory cytokine expression	Transfection and reporter gene assay	20451669	2010	Pubchem Assay
PRRID_0740	Peptidoglycan (PGN) Click for more detail	Gram-negative bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Synthetic	It mediates the effect through a TLR2/PI3K/Aktdependent mechanism.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Heart	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It induces induce cardioprotection against ischaemia/reperfusion injury	EMSA	20421349	2010	Pubchem Assay
PRRID_0740	Peptidoglycan (PGN) Click for more detail	Gram-negative bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Synthetic	It mediates the effect through a TLR2/PI3K/Aktdependent mechanism.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Heart	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It induces induce cardioprotection against ischaemia/reperfusion injury	EMSA	20421349	2010	Pubchem Assay
PRRID_0742	Pam3Cys Click for more detail	B. burgdorferi(Bacteria)	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Peptidoglycan	Synthetic	Induction of protective immunity correlated with the development of Abs against an epitope on the C-terminus of OspA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	dendritic cells, macrophages and lymphocytes	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It has the role in the inflammation.	NA	20713100	2010	Pubchem Assay
PRRID_0742	Pam3Cys Click for more detail	B. burgdorferi(Bacteria)	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Peptidoglycan	Synthetic	Induction of protective immunity correlated with the development of Abs against an epitope on the C-terminus of OspA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	dendritic cells, macrophages and lymphocytes	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It has the role in the inflammation.	NA	20713100	2010	Pubchem Assay
PRRID_0745	Peptidoglycan (PGN) Click for more detail	Gram-positive bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	Augment cytokines and chemokines expression and promoting enhanced PMN transalveolar migration and exaggerated lung inflammation in response to invading pathogens	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Lung's endothelial cell	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It has the role in the inflammation.	NA	20706658	2010	Pubchem Assay
PRRID_0745	Peptidoglycan (PGN) Click for more detail	Gram-positive bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	Augment cytokines and chemokines expression and promoting enhanced PMN transalveolar migration and exaggerated lung inflammation in response to invading pathogens	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Lung's endothelial cell	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It has the role in the inflammation.	NA	20706658	2010	Pubchem Assay
PRRID_0747	PGNpolymer Click for more detail	S. aureus (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	It initiates the activation of NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	HEK293	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It induced murine dendritic cell (DC) maturation and cytokine production.	Luciferase assay	20522786	2010	Pubchem Assay
PRRID_0747	PGNpolymer Click for more detail	S. aureus (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	It initiates the activation of NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	HEK293	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It induced murine dendritic cell (DC) maturation and cytokine production.	Luciferase assay	20522786	2010	Pubchem Assay
PRRID_0748	phenol-soluble modulin Click for more detail	Staphylococcus epidermis (Bacteria)	MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFGF	44	Protein	Natural	Increases expression of macrophage inflammatory protein-2 , cytokine migration inhibitory factor (MIF), and TNF-Œ± and induces augment PMN migration.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Lung's endothelial cell	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It has the role in the inflammation.	NA	20706658	2010	Pubchem Assay
PRRID_0748	phenol-soluble modulin Click for more detail	Staphylococcus epidermis (Bacteria)	MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFGF	44	Protein	Natural	Increases expression of macrophage inflammatory protein-2 , cytokine migration inhibitory factor (MIF), and TNF-Œ± and induces augment PMN migration.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Lung's endothelial cell	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It has the role in the inflammation.	NA	20706658	2010	Pubchem Assay
PRRID_0749	Phospholipomannan Click for more detail	Candida albicans(fungi)	NA	NA	Carbohydrate	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD88,/TIRAP and aloow the rerutiment of downstream effector	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Cell surface	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It leadsto the secretion of the proinfalmmatory cytokines	NA	20620129	2010	Pubchem Assay
PRRID_0749	Phospholipomannan Click for more detail	Candida albicans(fungi)	NA	NA	Carbohydrate	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD88,/TIRAP and aloow the rerutiment of downstream effector	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Cell surface	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It leadsto the secretion of the proinfalmmatory cytokines	NA	20620129	2010	Pubchem Assay
PRRID_0750	Phosphoprotein Click for more detail	Measles virus (virus)	MAEEQARHVKNGLECIRALKAEPIGSLAIEEAMAAWSEISDNPGQERATCREEKAGSSGLSKPCLSAIGSTEGGAPRIRGQGPGESDDDAETLGIPPRNLQASSTGLQCYYVYDHSGEAVKGIQDADSIMVQSGLDGDSTLSGGDNESENSDVDIGEPDTEGYAITDRGSAPISMGFRASDVETAEGGEIHELLRLQSRGNNFPKLGKTLNVPPPPDPGRASTSGTPIKKGTERRLASFGTEIASLLTGGATQCARKSPSEPSGPGAPAGNVPEYVSNAALIQEWTPESGTTISPRSQNNEEGGDYYDDELFSDVQDIKTALAKIHEDNQKIISKLESLLLLKGEVESIKKQINRQNISISTLEGHLSSIMIAIPGLGKDPNDPTADVEINPDLKPIIGRDSGRALAEVLKKPVASRQLQGMTNGRTSSRGQLLKEFQPKPIGKKMSSAVGFVPDTGPASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLMKIIMK	507	Protein	Natural	Suppress NF-Œ∫B and AP-1 activation (Upregulate host NF-Œ∫B negative regulator A20)	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Inhibit proinflammatory cytokine and chemokine production	NA	20672047	2010	NA
PRRID_0750	Phosphoprotein Click for more detail	Measles virus (virus)	MAEEQARHVKNGLECIRALKAEPIGSLAIEEAMAAWSEISDNPGQERATCREEKAGSSGLSKPCLSAIGSTEGGAPRIRGQGPGESDDDAETLGIPPRNLQASSTGLQCYYVYDHSGEAVKGIQDADSIMVQSGLDGDSTLSGGDNESENSDVDIGEPDTEGYAITDRGSAPISMGFRASDVETAEGGEIHELLRLQSRGNNFPKLGKTLNVPPPPDPGRASTSGTPIKKGTERRLASFGTEIASLLTGGATQCARKSPSEPSGPGAPAGNVPEYVSNAALIQEWTPESGTTISPRSQNNEEGGDYYDDELFSDVQDIKTALAKIHEDNQKIISKLESLLLLKGEVESIKKQINRQNISISTLEGHLSSIMIAIPGLGKDPNDPTADVEINPDLKPIIGRDSGRALAEVLKKPVASRQLQGMTNGRTSSRGQLLKEFQPKPIGKKMSSAVGFVPDTGPASRSVIRSIIKSSRLEEDRKRYLMTLLDDIKGANDLAKFHQMLMKIIMK	507	Protein	Natural	Suppress NF-Œ∫B and AP-1 activation (Upregulate host NF-Œ∫B negative regulator A20)	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Inhibit proinflammatory cytokine and chemokine production	NA	20672047	2010	NA
PRRID_0751	poly U Click for more detail	NA	NA	NA	Nucleic Acid	Synthetic	It led to the activation of NF-Œ∫B and upregulate the expression of the antiapoptotic protein Bcl-2.	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	Lung cancer cells	NA	Q9NYK1.fasta	Q9NYK1	1049	This resulted into increased tumor cell survival and resistance to apoptosis induced by chemotherapy.	ELISA	20237413	2010	Pubchem Assay
PRRID_0751	poly U Click for more detail	NA	NA	NA	Nucleic Acid	Synthetic	It led to the activation of NF-Œ∫B and upregulate the expression of the antiapoptotic protein Bcl-2.	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	Lung cancer cells	NA	Q9NYK1.fasta	Q9NYK1	1049	This resulted into increased tumor cell survival and resistance to apoptosis induced by chemotherapy.	ELISA	20237413	2010	Pubchem Assay
PRRID_0752	poly-UG dsRNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	production of IFN-‚ç∫, IL-6 and IL-1Œ≤	Toll-like receptor 3 (TLR3)/Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Chicken	Spleenocytes	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Immunostimulation and inflammation	NA	20692289	2010	NA
PRRID_0752	poly-UG dsRNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	production of IFN-‚ç∫, IL-6 and IL-1Œ≤	Toll-like receptor 3 (TLR3)/Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Chicken	Spleenocytes	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Immunostimulation and inflammation	NA	20692289	2010	NA
PRRID_0753	polyadenylic-polyuridylic acid Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	Their binding leads to the enhanced production of IFN-	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	mDCs	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It resulted in direct activation NK cells leading to high IFN-Œ≥ production.	NA	20639488	2010	Pubchem Assay
PRRID_0753	polyadenylic-polyuridylic acid Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	Their binding leads to the enhanced production of IFN-	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	mDCs	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It resulted in direct activation NK cells leading to high IFN-Œ≥ production.	NA	20639488	2010	Pubchem Assay
PRRID_0754	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Secretion of proinflammatory cytokines such as TFG-Œ≤ and IL-6	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	DF-MSCs & DP-MSCs	Tooth	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It has the role in the inflammation.	NA	20731536	2010	Pubchem Assay
PRRID_0754	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Secretion of proinflammatory cytokines such as TFG-Œ≤ and IL-6	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	DF-MSCs & DP-MSCs	Tooth	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It has the role in the inflammation.	NA	20731536	2010	Pubchem Assay
PRRID_0755	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	It results mTOR positively regulates interleukin 1 beta (IL-1Œ≤), tumor necrosis factor alpha (TNFŒ±) and interferon beta (IFN-Œ≤) expression, but negatively regulates IL-12p70 expression in keratinocytes	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Keratinocytes	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It leads to the inflammatory response from the immune system leads to the clearance of pathogens	NA	20728939	2010	Pubchem Assay
PRRID_0755	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	It results mTOR positively regulates interleukin 1 beta (IL-1Œ≤), tumor necrosis factor alpha (TNFŒ±) and interferon beta (IFN-Œ≤) expression, but negatively regulates IL-12p70 expression in keratinocytes	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Keratinocytes	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It leads to the inflammatory response from the immune system leads to the clearance of pathogens	NA	20728939	2010	Pubchem Assay
PRRID_0756	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Reduced HIV-1 expression	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Macrophages	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It leads to the clearance of the pathogen from the system	NA	20719993	2010	Pubchem Assay
PRRID_0756	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Reduced HIV-1 expression	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Macrophages	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It leads to the clearance of the pathogen from the system	NA	20719993	2010	Pubchem Assay
PRRID_0757	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	enhance the efficacy of peptide-based cancer vaccines by promoting tumor specific T cell responses	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Mice (Murine)	dendritic cells and macrophages	Leucine-rich Repeat (LRR) Domain	Q99MB1.fasta	Q99MB1	905	It has the role in the inflammation.	NA	20713100	2010	Pubchem Assay
PRRID_0757	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	enhance the efficacy of peptide-based cancer vaccines by promoting tumor specific T cell responses	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Mice (Murine)	dendritic cells and macrophages	Leucine-rich Repeat (LRR) Domain	Q99MB1.fasta	Q99MB1	905	It has the role in the inflammation.	NA	20713100	2010	Pubchem Assay
PRRID_0758	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	NA	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	organotypic Human brain slice cultures	Astrocytes	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It improves the survival of neurons	NA	20706642	2010	Pubchem Assay
PRRID_0758	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	NA	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	organotypic Human brain slice cultures	Astrocytes	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It improves the survival of neurons	NA	20706642	2010	Pubchem Assay
PRRID_0759	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	NA	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	CNS	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It causes neurodegeneration	NA	20706642	2010	NA
PRRID_0759	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	NA	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	CNS	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It causes neurodegeneration	NA	20706642	2010	NA
PRRID_0760	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	induced the secretion of IL-6 and IL-8	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	primary corneal epithelial cells and primary conjunctival epithelial cells, endothelial cells and fibroblasts	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It has the role in the inflammation.	NA	20703156	2010	Pubchem Assay
PRRID_0760	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	induced the secretion of IL-6 and IL-8	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	primary corneal epithelial cells and primary conjunctival epithelial cells, endothelial cells and fibroblasts	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It has the role in the inflammation.	NA	20703156	2010	Pubchem Assay
PRRID_0761	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	It results into the induction of type I IFNs	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Chicken	Spleenocytes	Leucine-rich Repeat (LRR) Domain	D6R3C9.fasta	D6R3C9	66	Immunostimulation	NA	20692289	2010	Pubchem Assay
PRRID_0761	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	It results into the induction of type I IFNs	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Chicken	Spleenocytes	Leucine-rich Repeat (LRR) Domain	D6R3C9.fasta	D6R3C9	66	Immunostimulation	NA	20692289	2010	Pubchem Assay
PRRID_0762	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Their binding leads to the enhanced production of type I IFNs	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	mDCs	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It resulted in direct activation NK cells leading to high IFN-Œ≥ production in synergy with mDC-released soluble mediators induced by dsRNA	NA	20639488	2010	Pubchem Assay
PRRID_0762	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Their binding leads to the enhanced production of type I IFNs	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	mDCs	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It resulted in direct activation NK cells leading to high IFN-Œ≥ production in synergy with mDC-released soluble mediators induced by dsRNA	NA	20639488	2010	Pubchem Assay
PRRID_0765	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	The binding of ligand to TLR3 results into induction of type I interferon inducible antiviral factors, including APOBEC3G and tetherin.	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Monocyte-derived macrophages	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	Activation of TLR-3 inhibits human immunodeficiency virus (HIV) replication and hence inhibits HIV-1 infection of macrophages	ELISA	20636339	2010	Pubchem Assay
PRRID_0765	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	The binding of ligand to TLR3 results into induction of type I interferon inducible antiviral factors, including APOBEC3G and tetherin.	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Monocyte-derived macrophages	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	Activation of TLR-3 inhibits human immunodeficiency virus (HIV) replication and hence inhibits HIV-1 infection of macrophages	ELISA	20636339	2010	Pubchem Assay
PRRID_0766	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	The binding results into secretion of low amounts of IL-12(p70) and high levels of IL-10 ompared with adult cells	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Cord blood cells	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	NA	NA	20636030	2010	Pubchem Assay
PRRID_0766	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	The binding results into secretion of low amounts of IL-12(p70) and high levels of IL-10 ompared with adult cells	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Cord blood cells	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	NA	NA	20636030	2010	Pubchem Assay
PRRID_0768	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	It stimulates the release of TNF-‚ç∫, IL-6 and CXCL1, and nitric oxide by microglia	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	Primary Microglial cells	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	Poly(I:C) increases microglial phagocytosis and intracellular killing of Escherichia coli K1, a pathogenic encapsulated bacterial strain	Phagocytosis assay	20599470	2010	Pubchem Assay
PRRID_0768	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	It stimulates the release of TNF-‚ç∫, IL-6 and CXCL1, and nitric oxide by microglia	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	Primary Microglial cells	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	Poly(I:C) increases microglial phagocytosis and intracellular killing of Escherichia coli K1, a pathogenic encapsulated bacterial strain	Phagocytosis assay	20599470	2010	Pubchem Assay
PRRID_0769	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	It's binding induces the production of IL6, IL8, MMP3 and MMP3	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Fibroblast Like Synoviocytes (FLS)	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It has a role in the pathogenesis of juvenile idiopathic arthritis and cartilage destruction	ELISA	20571165	2010	Pubchem Assay
PRRID_0769	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	It's binding induces the production of IL6, IL8, MMP3 and MMP3	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Fibroblast Like Synoviocytes (FLS)	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It has a role in the pathogenesis of juvenile idiopathic arthritis and cartilage destruction	ELISA	20571165	2010	Pubchem Assay
PRRID_0770	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Poly[I:C] stimulate the activaion of natural killer cells which leads to the secretion of IL-6 ,TNF-‚ç∫ and IFN-	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Natural Killer cells from peripheral blood	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It has a immunostimulatory role	Flex-Set cytokine assay	20427039	2010	Pubchem Assay
PRRID_0770	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	Poly[I:C] stimulate the activaion of natural killer cells which leads to the secretion of IL-6 ,TNF-‚ç∫ and IFN-	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Natural Killer cells from peripheral blood	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It has a immunostimulatory role	Flex-Set cytokine assay	20427039	2010	Pubchem Assay
PRRID_0773	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	It induces the release of microparticles by the macrophages	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	Macropahes	LRR	Q9QUK6.fasta	Q9QUK6	835	It leads to the release of MPs which act as the novel signals for innate immunity	Griess assay	20335312	2010	Pubchem Assay
PRRID_0773	polyinosinic-polycytidylic acid [poly(I:C)] Click for more detail	NA	C1=CN(C(=O)N=C1N)C2C(C(C(O2)COP(=O)(O)O)O)O.C1=NC(=O)C2=C(N1)N(C=N2)C3C(C(C(O3)COP(=O)(O)O)O)O	NA	Nucleic Acid	Synthetic	It induces the release of microparticles by the macrophages	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	Macropahes	LRR	Q9QUK6.fasta	Q9QUK6	835	It leads to the release of MPs which act as the novel signals for innate immunity	Griess assay	20335312	2010	Pubchem Assay
PRRID_0774	Polyporus polysaccharide Click for more detail	NA	NA	NA	Carbohydrate	Natural	enhanced cell-surface expression of CD86 and production of both interleukin (IL)-12p40 and IL-10	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	bone derived dendritic cells	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	It involved in BMDCs maturation by inducing phenotypic and functional hanges	ELISA	20673883	2010	Pubchem Assay
PRRID_0774	Polyporus polysaccharide Click for more detail	NA	NA	NA	Carbohydrate	Natural	enhanced cell-surface expression of CD86 and production of both interleukin (IL)-12p40 and IL-10	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	bone derived dendritic cells	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	It involved in BMDCs maturation by inducing phenotypic and functional hanges	ELISA	20673883	2010	Pubchem Assay
PRRID_0776	Porins Click for more detail	Neisseria meningitidis (Bacteria)	MRKKLTALVLSALPLAAVADVSLYGEIKAGVEGRNYQLQLTEAQAANGGASGQVKVTKVTKAKSRIRTKISDFGSFIGFKGSEDLGDGLKAVWQLEQDVSVAGGGATQWGNRESFIGLAGEFGTLRAGRVANQFDDASQAIDPWDSNNDVASQLGIFKRHDDMPVSVRYDSPEFSGFSGSVQFVPIQNSKSAYTPAYYTKNTNNNLTLVPAVVGKPGSDVYYAGLNYKNGGFAGNYAFKYARHANVGRNAFELFLIGSARSDQAKGTDPLKNHQVHRLTGGYEEGGLNLALAAQLDLSENGDKAKTKNSTTEIAATASYRFGNAVPRISYAHGFDFIERGKKGENTSYDQIIAGVDYDFSKRTSAIVSGAWLKRNTGIGNYTQINAASVGLRHKF	396	Protein	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	NA	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	20679445	2010	NA
PRRID_0776	Porins Click for more detail	Neisseria meningitidis (Bacteria)	MRKKLTALVLSALPLAAVADVSLYGEIKAGVEGRNYQLQLTEAQAANGGASGQVKVTKVTKAKSRIRTKISDFGSFIGFKGSEDLGDGLKAVWQLEQDVSVAGGGATQWGNRESFIGLAGEFGTLRAGRVANQFDDASQAIDPWDSNNDVASQLGIFKRHDDMPVSVRYDSPEFSGFSGSVQFVPIQNSKSAYTPAYYTKNTNNNLTLVPAVVGKPGSDVYYAGLNYKNGGFAGNYAFKYARHANVGRNAFELFLIGSARSDQAKGTDPLKNHQVHRLTGGYEEGGLNLALAAQLDLSENGDKAKTKNSTTEIAATASYRFGNAVPRISYAHGFDFIERGKKGENTSYDQIIAGVDYDFSKRTSAIVSGAWLKRNTGIGNYTQINAASVGLRHKF	396	Protein	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	NA	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	20679445	2010	NA
PRRID_0779	PS-G Click for more detail	Ganoderma lucidum (fungi)	NA	NA	Carbohydrate	Natural	Binding resulted into the activation of NF-	Toll-like receptor 5 (TLR5)	Toll-like receptor (TLR)	Mice (Murine)	bone derived dendritic cells	Leucine-rich Repeat (LRR) Domain	Q9JLF7.fasta	Q9JLF7	859	promote the activation and maturation of BMDCs and macrophages	NA	20673883	2010	Pubchem Assay
PRRID_0779	PS-G Click for more detail	Ganoderma lucidum (fungi)	NA	NA	Carbohydrate	Natural	Binding resulted into the activation of NF-	Toll-like receptor 5 (TLR5)	Toll-like receptor (TLR)	Mice (Murine)	bone derived dendritic cells	Leucine-rich Repeat (LRR) Domain	Q9JLF7.fasta	Q9JLF7	859	promote the activation and maturation of BMDCs and macrophages	NA	20673883	2010	Pubchem Assay
PRRID_0781	R-Lipopolysaccharide (LPS) Click for more detail	Salmonella minnesota (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	Activate monocytes and neutrophils with differential CD14 expression.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Monocytes and Neutrophils	Leucine-rich Repeat (LRR) Domain	O00206.fasta	O00206	839	It leads to the inflammatory response from the immune system leads to the clearance of pathogens	NA	20721471	2010	Pubchem Assay
PRRID_0781	R-Lipopolysaccharide (LPS) Click for more detail	Salmonella minnesota (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	Activate monocytes and neutrophils with differential CD14 expression.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Monocytes and Neutrophils	Leucine-rich Repeat (LRR) Domain	O00206.fasta	O00206	839	It leads to the inflammatory response from the immune system leads to the clearance of pathogens	NA	20721471	2010	Pubchem Assay
PRRID_0782	Resiquimod (R-848) Click for more detail	imidazoquinoline (others)	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Nucleic Acid	Synthetic	The binding results into the robust TNF-‚ç∫ and IL-12 production	Toll-like receptor 7/8 (TLR7/8)	Toll-like receptor (TLR)	Human	APCs	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	20636030	2010	NA
PRRID_0782	Resiquimod (R-848) Click for more detail	imidazoquinoline (others)	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Nucleic Acid	Synthetic	The binding results into the robust TNF-‚ç∫ and IL-12 production	Toll-like receptor 7/8 (TLR7/8)	Toll-like receptor (TLR)	Human	APCs	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	20636030	2010	NA
PRRID_0783	RID Click for more detail	Adenovirus(virus)	MVTPLLLLVCLPIIYASTTFAAVSHLDTDCLPALLTYLIFTSVCCTAICSIATFFVAIFQTADYLYVRVAYYRHHPQYRNHEVATLLCLS	90	Protein	Natural	Suppress NF-Œ∫B and AP-1 activation	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O00206.fasta	O00206	839	Suppress MCP-1 and IL-8 production	NA	20672047	2010	Pubchem Assay
PRRID_0783	RID Click for more detail	Adenovirus(virus)	MVTPLLLLVCLPIIYASTTFAAVSHLDTDCLPALLTYLIFTSVCCTAICSIATFFVAIFQTADYLYVRVAYYRHHPQYRNHEVATLLCLS	90	Protein	Natural	Suppress NF-Œ∫B and AP-1 activation	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O00206.fasta	O00206	839	Suppress MCP-1 and IL-8 production	NA	20672047	2010	Pubchem Assay
PRRID_0784	rlipo-D1E3 Click for more detail	Dengue virus(virus)	NA	NA	Recombinant lipoprotein	Synthetic	It activated the NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Spleen cells and Bone-Marrow derived dendritic cells	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It promote various immune responses by inducing different levels of biological cytokines and chemokines.	NF-	20478617	2010	Pubchem Assay
PRRID_0784	rlipo-D1E3 Click for more detail	Dengue virus(virus)	NA	NA	Recombinant lipoprotein	Synthetic	It activated the NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Spleen cells and Bone-Marrow derived dendritic cells	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It promote various immune responses by inducing different levels of biological cytokines and chemokines.	NF-	20478617	2010	Pubchem Assay
PRRID_0785	RNA40 Click for more detail	HIV-1 (virus)	NA	NA	Nucleic Acid	Natural	Activate IRF-7 mediated by MyD88	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Activate pDCs	NA	20672047	2010	NA
PRRID_0785	RNA40 Click for more detail	HIV-1 (virus)	NA	NA	Nucleic Acid	Natural	Activate IRF-7 mediated by MyD88	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Activate pDCs	NA	20672047	2010	NA
PRRID_0786	S-[2,3-bispalmitoyiloxy-(2R)-propyl]- R-cysteinyl-amido-monomethoxyl polyethylene glycol (BPPcysMPEG Click for more detail	NA	NA	NA	Adjuvant	Synthetic	It activates the TLR2/6 heterodimer.	Toll-like receptor 2/6 (TLR2/6)	Toll-like receptor (TLR)	Mice	Dendritic cells	NA	NA	NA	NA	It leads to efficient cross-priming against co-administered and linked antigens.	Cytotoxicity assay	20213735	2010	NA
PRRID_0786	S-[2,3-bispalmitoyiloxy-(2R)-propyl]- R-cysteinyl-amido-monomethoxyl polyethylene glycol (BPPcysMPEG Click for more detail	NA	NA	NA	Adjuvant	Synthetic	It activates the TLR2/6 heterodimer.	Toll-like receptor 2/6 (TLR2/6)	Toll-like receptor (TLR)	Mice	Dendritic cells	NA	NA	NA	NA	It leads to efficient cross-priming against co-administered and linked antigens.	Cytotoxicity assay	20213735	2010	NA
PRRID_0787	S-Lipopolysaccharide (LPS) Click for more detail	Salmonella abortus equi (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	Activate monocytes and neutrophils with differential CD14 expression.	Toll-like receptor 5 (TLR5)	Toll-like receptor (TLR)	Human	Monocytes and Neutrophils	Leucine-rich Repeat (LRR) Domain	O60602.fasta	O60602	858	It leads to the inflammatory response from the immune system leads to the clearance of pathogens	NA	20721471	2010	Pubchem Assay
PRRID_0787	S-Lipopolysaccharide (LPS) Click for more detail	Salmonella abortus equi (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	Activate monocytes and neutrophils with differential CD14 expression.	Toll-like receptor 5 (TLR5)	Toll-like receptor (TLR)	Human	Monocytes and Neutrophils	Leucine-rich Repeat (LRR) Domain	O60602.fasta	O60602	858	It leads to the inflammatory response from the immune system leads to the clearance of pathogens	NA	20721471	2010	Pubchem Assay
PRRID_0788	SE-derived secreted factor (SE-S) Click for more detail	Staphylococcus epidermidis strain 1457 (Bacteria)	MNYSKITVTLIIILLCTFSFEFSFNRFVQADESRPKIESLKKKSELDSTALYNIKTSYSQDNIILDIKNKTNSTQLLSNDLIFDDITLKEWNKNSLKTEFNSSEIANHFKGKKVDIFGIYYGANCIGEVSKRTGCIYGGITLHEEEKIDQKNSIGVNVFKDGSQQKGFMITTDKKEPTIQELDLKTRKVIQNQYKIYNSETGNIQKGYMEFHSNSSSFYYDLFNFKGKYSVDFLKFYNDNKTINSSNLHIDVYLYSQ	257	Soluble factor	Natural	TLR2 mediated SE-induced cytokine production such as TNF, CXCL1 and CXCL2	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	human embryonic kidney cells, human whole blood and murine primary macrophages	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	TLR2 mediates recognition of live SE and clearance of SE bacteremia.	Cytokines assay	20404927	2010	Pubchem Assay
PRRID_0788	SE-derived secreted factor (SE-S) Click for more detail	Staphylococcus epidermidis strain 1457 (Bacteria)	MNYSKITVTLIIILLCTFSFEFSFNRFVQADESRPKIESLKKKSELDSTALYNIKTSYSQDNIILDIKNKTNSTQLLSNDLIFDDITLKEWNKNSLKTEFNSSEIANHFKGKKVDIFGIYYGANCIGEVSKRTGCIYGGITLHEEEKIDQKNSIGVNVFKDGSQQKGFMITTDKKEPTIQELDLKTRKVIQNQYKIYNSETGNIQKGYMEFHSNSSSFYYDLFNFKGKYSVDFLKFYNDNKTINSSNLHIDVYLYSQ	257	Soluble factor	Natural	TLR2 mediated SE-induced cytokine production such as TNF, CXCL1 and CXCL2	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	human embryonic kidney cells, human whole blood and murine primary macrophages	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	TLR2 mediates recognition of live SE and clearance of SE bacteremia.	Cytokines assay	20404927	2010	Pubchem Assay
PRRID_0789	SE-derived secreted factor (SE-S) Click for more detail	Staphylococcus epidermidis strain 1457 (Bacteria)	MNYSKITVTLIIILLCTFSFEFSFNRFVQADESRPKIESLKKKSELDSTALYNIKTSYSQDNIILDIKNKTNSTQLLSNDLIFDDITLKEWNKNSLKTEFNSSEIANHFKGKKVDIFGIYYGANCIGEVSKRTGCIYGGITLHEEEKIDQKNSIGVNVFKDGSQQKGFMITTDKKEPTIQELDLKTRKVIQNQYKIYNSETGNIQKGYMEFHSNSSSFYYDLFNFKGKYSVDFLKFYNDNKTINSSNLHIDVYLYSQ	257	Soluble factor	Natural	TLR2 mediated SE-induced cytokine production such as TNF, CXCL1 and CXCL2	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	human embryonic kidney cells, human whole blood and murine primary macrophages	Leucine-rich Repeat (LRR) Domain	Q99MB1.fasta	Q99MB1	905	TLR2 mediates recognition of live SE and clearance of SE bacteremia.	Cytokines assay	20404927	2010	Pubchem Assay
PRRID_0789	SE-derived secreted factor (SE-S) Click for more detail	Staphylococcus epidermidis strain 1457 (Bacteria)	MNYSKITVTLIIILLCTFSFEFSFNRFVQADESRPKIESLKKKSELDSTALYNIKTSYSQDNIILDIKNKTNSTQLLSNDLIFDDITLKEWNKNSLKTEFNSSEIANHFKGKKVDIFGIYYGANCIGEVSKRTGCIYGGITLHEEEKIDQKNSIGVNVFKDGSQQKGFMITTDKKEPTIQELDLKTRKVIQNQYKIYNSETGNIQKGYMEFHSNSSSFYYDLFNFKGKYSVDFLKFYNDNKTINSSNLHIDVYLYSQ	257	Soluble factor	Natural	TLR2 mediated SE-induced cytokine production such as TNF, CXCL1 and CXCL2	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	human embryonic kidney cells, human whole blood and murine primary macrophages	Leucine-rich Repeat (LRR) Domain	Q99MB1.fasta	Q99MB1	905	TLR2 mediates recognition of live SE and clearance of SE bacteremia.	Cytokines assay	20404927	2010	Pubchem Assay
PRRID_0790	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	Q9NYK1.fasta	Q9NYK1	1049	It coauses the inflammation	NA	20740341	2010	Pubchem Assay
PRRID_0790	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	Q9NYK1.fasta	Q9NYK1	1049	It coauses the inflammation	NA	20740341	2010	Pubchem Assay
PRRID_0791	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	It coauses the inflammation	NA	20740341	2010	Pubchem Assay
PRRID_0791	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	It coauses the inflammation	NA	20740341	2010	Pubchem Assay
PRRID_0792	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	release of proinflammatory cytokines and Pathgen Clearance	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice	NA	Leucine-rich Repeat (LRR) Domain	P58681.fasta	P58681	1050	It has the role in the inflammation.	NA	20739362	2010	Pubchem Assay
PRRID_0792	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	release of proinflammatory cytokines and Pathgen Clearance	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Mice	NA	Leucine-rich Repeat (LRR) Domain	P58681.fasta	P58681	1050	It has the role in the inflammation.	NA	20739362	2010	Pubchem Assay
PRRID_0793	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	lipid mediators of inflammation	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human(Ovarian Cancer Patient)	NA	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	It leads to the inflammatory response from the immune system leads to the clearance of pathogens	NA	20728343	2010	Pubchem Assay
PRRID_0793	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	lipid mediators of inflammation	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human(Ovarian Cancer Patient)	NA	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	It leads to the inflammatory response from the immune system leads to the clearance of pathogens	NA	20728343	2010	Pubchem Assay
PRRID_0794	single-stranded RNA Click for more detail	HIV-1 (virus)	NA	NA	Nucleic Acid	Natural	It suppresses virus replication	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	plasmacytoid DCs	Leucine-rich Repeat (LRR) Domain	Q9NYK1.fasta	Q9NYK1	1049	It leads to the clearance of the pathogen from the system	NA	20719993	2010	Pubchem Assay
PRRID_0794	single-stranded RNA Click for more detail	HIV-1 (virus)	NA	NA	Nucleic Acid	Natural	It suppresses virus replication	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	plasmacytoid DCs	Leucine-rich Repeat (LRR) Domain	Q9NYK1.fasta	Q9NYK1	1049	It leads to the clearance of the pathogen from the system	NA	20719993	2010	Pubchem Assay
PRRID_0795	single-stranded RNA Click for more detail	HIV-1 (virus)	NA	NA	Nucleic Acid	Natural	It suppresses virus replication	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	plasmacytoid DCs	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	It leads to the clearance of the pathogen from the system	NA	20719993	2010	Pubchem Assay
PRRID_0795	single-stranded RNA Click for more detail	HIV-1 (virus)	NA	NA	Nucleic Acid	Natural	It suppresses virus replication	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	plasmacytoid DCs	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	It leads to the clearance of the pathogen from the system	NA	20719993	2010	Pubchem Assay

previous 1 2...7 8 91011 12 13...69 70 next