Browse result page of PRRDB 2.0

PRRID	Name of Ligand	Source of ligand	Sequence of Ligand	Length of Ligand	Type of Ligand	Occurence	Role of Ligand	Name of Receptor	Type of Reeptor	Source of the Receptor	Localization	Domain	Sequence of Receptor	Swiss prot ID	Length of receptor	Function of Receptor	Assay used	PMID	Year of publication	Pubchem assay
PRRID_0796	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	It produce pro-inflammatory cytokines including IFNŒ±, TNFŒ± and/or IL-12	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	DCs, monocytes, macrophages, lymphocytes, Langerhans cells, and NK cells	Leucine-rich Repeat (LRR) Domain	Q9NYK1.fasta	Q9NYK1	1049	Itresults into the inflammatory response	NA	20713100	2010	Pubchem Assay
PRRID_0796	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	It produce pro-inflammatory cytokines including IFNŒ±, TNFŒ± and/or IL-12	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	DCs, monocytes, macrophages, lymphocytes, Langerhans cells, and NK cells	Leucine-rich Repeat (LRR) Domain	Q9NYK1.fasta	Q9NYK1	1049	Itresults into the inflammatory response	NA	20713100	2010	Pubchem Assay
PRRID_0797	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	It produce pro-inflammatory cytokines including IFNŒ±, TNFŒ± and/or IL-12	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	DCs, monocytes, macrophages, lymphocytes, Langerhans cells, and NK cells	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	Itresults into the inflammatory response	NA	20713100	2010	Pubchem Assay
PRRID_0797	single-stranded RNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	It produce pro-inflammatory cytokines including IFNŒ±, TNFŒ± and/or IL-12	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	DCs, monocytes, macrophages, lymphocytes, Langerhans cells, and NK cells	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	Itresults into the inflammatory response	NA	20713100	2010	Pubchem Assay
PRRID_0798	single-stranded RNA Click for more detail	West Nile Virus	NA	NA	Nucleic Acid	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins TRIF	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Endosomes	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	it lead to the secretion of IFN-Œ≤	NA	20620129	2010	Pubchem Assay
PRRID_0798	single-stranded RNA Click for more detail	West Nile Virus	NA	NA	Nucleic Acid	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins TRIF	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Endosomes	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	it lead to the secretion of IFN-Œ≤	NA	20620129	2010	Pubchem Assay
PRRID_0799	single-stranded RNA Click for more detail	VSV, Influenza virus	NA	NA	Nucleic Acid	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD89	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	Endosomes	Leucine-rich Repeat (LRR) Domain	Q9NYK1.fasta	Q9NYK1	1049	It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫	NA	20620129	2010	Pubchem Assay
PRRID_0799	single-stranded RNA Click for more detail	VSV, Influenza virus	NA	NA	Nucleic Acid	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD89	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	Endosomes	Leucine-rich Repeat (LRR) Domain	Q9NYK1.fasta	Q9NYK1	1049	It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫	NA	20620129	2010	Pubchem Assay
PRRID_0800	single-stranded RNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD90	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	Endosomes	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫	NA	20620129	2010	Pubchem Assay
PRRID_0800	single-stranded RNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD90	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	Endosomes	Leucine-rich Repeat (LRR) Domain	Q9NR97.fasta	Q9NR97	1041	It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫	NA	20620129	2010	Pubchem Assay
PRRID_0801	siSC2 dsRNA Click for more detail	NA	NA	NA	Nucleic Acid	Synthetic	Induce type 1 IFN production	Toll-like receptor 3 (TLR3)/Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	PBMCs	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Immunostimulation	NA	20692289	2010	NA
PRRID_0801	siSC2 dsRNA Click for more detail	NA	NA	NA	Nucleic Acid	Synthetic	Induce type 1 IFN production	Toll-like receptor 3 (TLR3)/Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	PBMCs	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Immunostimulation	NA	20692289	2010	NA
PRRID_0802	SitC-His Click for more detail	S. aureus (Bacteria)	NA	NA	Lipoprotein	Natural	Induce IL-6 and TNF-‚ç∫ release	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Monocytes	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	NA	NA	20679445	2010	Pubchem Assay
PRRID_0802	SitC-His Click for more detail	S. aureus (Bacteria)	NA	NA	Lipoprotein	Natural	Induce IL-6 and TNF-‚ç∫ release	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Monocytes	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	NA	NA	20679445	2010	Pubchem Assay
PRRID_0803	SitC-His Click for more detail	S. aureus (Bacteria)	NA	NA	Lipoprotein	Natural	Activation of NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	HEK293	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	NA	NA	20679445	2010	Pubchem Assay
PRRID_0803	SitC-His Click for more detail	S. aureus (Bacteria)	NA	NA	Lipoprotein	Natural	Activation of NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	HEK293	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	NA	NA	20679445	2010	Pubchem Assay
PRRID_0804	SMP-105 Click for more detail	M. bovis BCG Tokyo 172 (Bacteria)	NA	NA	Cell-wall Skeleton	Natural	Binding of SMP-105 to TLR2 leads to the production of IL-12 p40 cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	C57BL/6J mice	BC-1 (Immature Dendritic cell line)	NA	Q9QUN7.fasta	Q9QUN7	784	It leads to the maturation and activation of BC-1.	ELISA	22491171	2010	Pubchem Assay
PRRID_0804	SMP-105 Click for more detail	M. bovis BCG Tokyo 172 (Bacteria)	NA	NA	Cell-wall Skeleton	Natural	Binding of SMP-105 to TLR2 leads to the production of IL-12 p40 cytokines	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	C57BL/6J mice	BC-1 (Immature Dendritic cell line)	NA	Q9QUN7.fasta	Q9QUN7	784	It leads to the maturation and activation of BC-1.	ELISA	22491171	2010	Pubchem Assay
PRRID_0805	sonifilan Click for more detail	Schizophyllum commune (fungi)	C(C1C(C(C(C(O1)O)O)OC2C(C(C(C(O2)COC3C(C(C(C(O3)CO)O)O)O)O)OC4C(C(C(C(O4)CO)O)O)O)O)O)O	NA	Biological response modifiers (BRMs)	Natural	Medicinal properties	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	dendritic cells and macrophages	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	used clinically for cancer therapy	NA	20699131	2010	Pubchem Assay
PRRID_0805	sonifilan Click for more detail	Schizophyllum commune (fungi)	C(C1C(C(C(C(O1)O)O)OC2C(C(C(C(O2)COC3C(C(C(C(O3)CO)O)O)O)O)OC4C(C(C(C(O4)CO)O)O)O)O)O)O	NA	Biological response modifiers (BRMs)	Natural	Medicinal properties	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	dendritic cells and macrophages	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	used clinically for cancer therapy	NA	20699131	2010	Pubchem Assay
PRRID_0809	SS Rna and CpG DNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	NA	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice (Murine)	NA	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	NA	NA	20739519	2010	Pubchem Assay
PRRID_0809	SS Rna and CpG DNA Click for more detail	Virus	NA	NA	Nucleic Acid	Natural	NA	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice (Murine)	NA	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	NA	NA	20739519	2010	Pubchem Assay
PRRID_0810	Stathmins Click for more detail	Human (others)	MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD	149	Endogenous	Natural	Binding of stathmins to TLR3 activates downstream signalling pathways via TRIF and lead to the secretion of IL-6 and CXCL-8	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Astrocytes and microglia	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It has a role in astrocyte-mediated neuroprotection and in morphogenesis in the CNS	NA	20483774	2010	Pubchem Assay
PRRID_0810	Stathmins Click for more detail	Human (others)	MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD	149	Endogenous	Natural	Binding of stathmins to TLR3 activates downstream signalling pathways via TRIF and lead to the secretion of IL-6 and CXCL-8	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Astrocytes and microglia	Leucine-rich Repeat (LRR) Domain	O15455.fasta	O15455	904	It has a role in astrocyte-mediated neuroprotection and in morphogenesis in the CNS	NA	20483774	2010	Pubchem Assay
PRRID_0811	Stathmins Click for more detail	Human (others)	MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD	149	Endogenous	Natural	Binding of stathmins to TLR3 activates downstream signalling pathways via TRIF and lead to the secretion of IL-6 and CXCL-8	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Mice (Murine)	Astrocytes and microglia	Leucine-rich Repeat (LRR) Domain	Q99MB1.fasta	Q99MB1	905	It has a role in astrocyte-mediated neuroprotection and in morphogenesis in the CNS	NA	20483774	2010	Pubchem Assay
PRRID_0811	Stathmins Click for more detail	Human (others)	MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD	149	Endogenous	Natural	Binding of stathmins to TLR3 activates downstream signalling pathways via TRIF and lead to the secretion of IL-6 and CXCL-8	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Mice (Murine)	Astrocytes and microglia	Leucine-rich Repeat (LRR) Domain	Q99MB1.fasta	Q99MB1	905	It has a role in astrocyte-mediated neuroprotection and in morphogenesis in the CNS	NA	20483774	2010	Pubchem Assay
PRRID_0812	Surface structure Click for more detail	Virus	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	NA	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	NA	NA	20739519	2010	Pubchem Assay
PRRID_0812	Surface structure Click for more detail	Virus	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice (Murine)	NA	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	NA	NA	20739519	2010	Pubchem Assay
PRRID_0813	Surface structure Click for more detail	Virus	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	NA	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	NA	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	NA	NA	20739519	2010	Pubchem Assay
PRRID_0813	Surface structure Click for more detail	Virus	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	NA	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	NA	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	NA	NA	20739519	2010	Pubchem Assay
PRRID_0816	Tat Click for more detail	HIV-1 (virus)	MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQPRGDPTGPKE	86	Protein	Natural	Activate NF-Œ∫B (PKR-dependent)	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	20672047	2010	NA
PRRID_0816	Tat Click for more detail	HIV-1 (virus)	MEPVDPRLEPWKHPGSQPKTACTNCYCKKCCFHCQVCFITKALGISYGRKKRRQRRRAHQNSQTHQASLSKQPTSQPRGDPTGPKE	86	Protein	Natural	Activate NF-Œ∫B (PKR-dependent)	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	NA	NA	20672047	2010	NA
PRRID_0817	Triacetylated lipoproteins Click for more detail	M. tuberculosis (Bacteria)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	On binding to the receptor it, activates the heterocomplex of TLR2/6 and secretion of cytokines takes place	Toll-like receptor 2/1 (TLR2/1)	Toll-like receptor (TLR)	DNA samples from peripheral blood of TB patients	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Immunostimulation and inflammation	NA	20797905	2010	NA
PRRID_0817	Triacetylated lipoproteins Click for more detail	M. tuberculosis (Bacteria)	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	On binding to the receptor it, activates the heterocomplex of TLR2/6 and secretion of cytokines takes place	Toll-like receptor 2/1 (TLR2/1)	Toll-like receptor (TLR)	DNA samples from peripheral blood of TB patients	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Immunostimulation and inflammation	NA	20797905	2010	NA
PRRID_0818	Triacylated lipopeptides Click for more detail	Bacteria	NA	NA	Lipopeptides	Natural	Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins	Toll-like receptor 2 (TLR2)-Toll-like receptor (TLR1 dimer)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It coauses the inflammation	NA	20740341	2010	NA
PRRID_0818	Triacylated lipopeptides Click for more detail	Bacteria	NA	NA	Lipopeptides	Natural	Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins	Toll-like receptor 2 (TLR2)-Toll-like receptor (TLR1 dimer)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It coauses the inflammation	NA	20740341	2010	NA
PRRID_0819	Triacylated lipopeptides Click for more detail	Bacteria and Mycobacteria	NA	NA	Lipopeptides	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD88,/TIRAP and aloow the rerutiment of downstream effector	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	Cell surface	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It leadsto the secretion of the proinfalmmatory cytokines	NA	20620129	2010	NA
PRRID_0819	Triacylated lipopeptides Click for more detail	Bacteria and Mycobacteria	NA	NA	Lipopeptides	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD88,/TIRAP and aloow the rerutiment of downstream effector	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	Cell surface	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It leadsto the secretion of the proinfalmmatory cytokines	NA	20620129	2010	NA
PRRID_0820	Type A CpG-ODN Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	The bindinginduces IFN-‚ç∫	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	NA	plasmacytoid DCs	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It provides immunity against the bacterial infection	NA	20636030	2010	NA
PRRID_0820	Type A CpG-ODN Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	The bindinginduces IFN-‚ç∫	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	NA	plasmacytoid DCs	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It provides immunity against the bacterial infection	NA	20636030	2010	NA
PRRID_0821	Type B CpG-ODN Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	It activates macrophages and B-cells	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	NA	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It promotes the enhancement of antibody production	NA	20636030	2010	NA
PRRID_0821	Type B CpG-ODN Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	It activates macrophages and B-cells	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	NA	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It promotes the enhancement of antibody production	NA	20636030	2010	NA
PRRID_0822	Type C CpG-ODN Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	It induces IFN-‚ç∫ and activates macrophages and B-cells	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	NA	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It promotes the enhancement of antibody production and provides immunity against bacterial infection	NA	20636030	2010	NA
PRRID_0822	Type C CpG-ODN Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	It induces IFN-‚ç∫ and activates macrophages and B-cells	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	NA	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It promotes the enhancement of antibody production and provides immunity against bacterial infection	NA	20636030	2010	NA
PRRID_0825	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	It leads to the maturation, differentiation, and/or proliferation of NK cells, T cells, B cells, monocytes and macrophages and production of pro-inflammatory and Th-1 biased cytokines	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	B cells and pDC	NA	Q9NR96.fasta	Q9NR96	1032	It has the role in the inflammation.	NA	20713100	2010	Pubchem Assay
PRRID_0825	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	It leads to the maturation, differentiation, and/or proliferation of NK cells, T cells, B cells, monocytes and macrophages and production of pro-inflammatory and Th-1 biased cytokines	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	B cells and pDC	NA	Q9NR96.fasta	Q9NR96	1032	It has the role in the inflammation.	NA	20713100	2010	Pubchem Assay
PRRID_0826	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	It leads to the activation of the TLR9 and results into the secretion of the cytokines	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	It has the role in the inflammation.	NA	20706677	2010	Pubchem Assay
PRRID_0826	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	It leads to the activation of the TLR9 and results into the secretion of the cytokines	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	It has the role in the inflammation.	NA	20706677	2010	Pubchem Assay
PRRID_0827	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	It's binding does not induces the production of IL6, IL8, MMP3 and MMP4	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	Fibroblast Like Synoviocytes (FLS)	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	It has a role in the pathogenesis of juvenile idiopathic arthritis and cartilage destruction	ELISA	20571165	2010	Pubchem Assay
PRRID_0827	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	It's binding does not induces the production of IL6, IL8, MMP3 and MMP4	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	Fibroblast Like Synoviocytes (FLS)	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	It has a role in the pathogenesis of juvenile idiopathic arthritis and cartilage destruction	ELISA	20571165	2010	Pubchem Assay
PRRID_0828	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	The binding leads to the activation of the NF-	chToll-like receptor 21 (TLR21)	Toll-like receptor (TLR)	Chicken	HD11 macrophage	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It leads to the inflammatory response from the immune system leads to the clearance of pathogens	Luciferase assay	20498358	2010	NA
PRRID_0828	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	The binding leads to the activation of the NF-	chToll-like receptor 21 (TLR21)	Toll-like receptor (TLR)	Chicken	HD11 macrophage	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It leads to the inflammatory response from the immune system leads to the clearance of pathogens	Luciferase assay	20498358	2010	NA
PRRID_0829	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	It leads to increased expression of cytokine IL-12 p41	Toll-like receptor 21 (TLR2)	Toll-like receptor (TLR)	Chicken	Macrophage-like cell line (HD11)	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	This results into the inflammatory response.	NA	20471186	2010	NA
PRRID_0829	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	It leads to increased expression of cytokine IL-12 p41	Toll-like receptor 21 (TLR2)	Toll-like receptor (TLR)	Chicken	Macrophage-like cell line (HD11)	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	This results into the inflammatory response.	NA	20471186	2010	NA
PRRID_0830	Uropathogenic E. coli Click for more detail	Bacteria	NA	NA	NA	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD94	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	Cell surface	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫	NA	20620129	2010	Pubchem Assay
PRRID_0830	Uropathogenic E. coli Click for more detail	Bacteria	NA	NA	NA	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD94	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	Cell surface	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	It leadsto the secretion of the proinfalmmatory and IFN-‚ç∫	NA	20620129	2010	Pubchem Assay
PRRID_0831	Viral DNA Click for more detail	herpes simplex virus (virus)	NA	NA	Nucleic Acid	Natural	NA	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	Induce IFN production	NA	20672047	2010	Pubchem Assay
PRRID_0831	Viral DNA Click for more detail	herpes simplex virus (virus)	NA	NA	Nucleic Acid	Natural	NA	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	Induce IFN production	NA	20672047	2010	Pubchem Assay
PRRID_0832	viral envelope proteins Click for more detail	RSV and MMTV (virus)	NA	NA	Nucleic Acid	Natural	NA	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	dendritic cells and macrophages	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	NA	NA	20713100	2010	Pubchem Assay
PRRID_0832	viral envelope proteins Click for more detail	RSV and MMTV (virus)	NA	NA	Nucleic Acid	Natural	NA	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice (Murine)	dendritic cells and macrophages	Leucine-rich Repeat (LRR) Domain	Q9QUK6.fasta	Q9QUK6	835	NA	NA	20713100	2010	Pubchem Assay
PRRID_0834	Viral RNA Click for more detail	Hepatitis C Virus (virus)	NA	NA	Nucleic Acid	Natural	The binding induces rapid interferon responses	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	NA	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	NA	NA	20677943	2010	Pubchem Assay
PRRID_0834	Viral RNA Click for more detail	Hepatitis C Virus (virus)	NA	NA	Nucleic Acid	Natural	The binding induces rapid interferon responses	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	NA	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	NA	NA	20677943	2010	Pubchem Assay
PRRID_0836	virions Click for more detail	EBV(virus)	MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY	NA	Virus	Natural	Release of monocyte chemoattractant protein-1 (MCP-1) and to an increase of several cytokine mRNA levels.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Monocytes	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It provides antiviral immunity.	NA	20713890	2010	Pubchem Assay
PRRID_0836	virions Click for more detail	EBV(virus)	MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY	NA	Virus	Natural	Release of monocyte chemoattractant protein-1 (MCP-1) and to an increase of several cytokine mRNA levels.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Monocytes	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It provides antiviral immunity.	NA	20713890	2010	Pubchem Assay
PRRID_0837	virions Click for more detail	herpes simplex virus (virus)	MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY	NA	Virus	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	Induce cytokine production	NA	20672047	2010	Pubchem Assay
PRRID_0837	virions Click for more detail	herpes simplex virus (virus)	MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY	NA	Virus	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	Induce cytokine production	NA	20672047	2010	Pubchem Assay
PRRID_0838	virions Click for more detail	Varicella-zoster (virus)	MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY	NA	Virus	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	Induce cytokine production	NA	20672047	2010	Pubchem Assay
PRRID_0838	virions Click for more detail	Varicella-zoster (virus)	MAKLETVTLGNIGKDGKQTLVLNPRGVNPTNGVASLSQAGAVPALEKRVTVSVSQPSRNRKNYKVQVKIQNPTACTANGSCDPSVTRQAYADVTFSFTQYSTDEERAFVRTELAALLASPLLIDAIDQLNPAY	NA	Virus	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	Induce cytokine production	NA	20672047	2010	Pubchem Assay
PRRID_0839	Virulence factor p60 Click for more detail	Listeriamonocytogenes (Bacteria)	MKKIMLVFITLILVSLPIAQQTEAKDASAFNKENSISSMAPPASPPASPKTPIEKKHADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKKKKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTNQDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVNAENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGGSAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVIKNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEVNYDPEGNEIVQHKNWSENNKSKLAHFTSSIYLPGNARNINVYAKECTGLAWEWWRTVIDDRNLPLVKNRNISIWGTTLYPKYSNKVDNPIE	529	Protein	Natural	It activates of nuclear factor kB (NF-kB) and induces proinflammatory cytokine production.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Macropahes	LRR	Q9QUK6.fasta	Q9QUK6	835	It provides host resistance against infection with L. monocytogenes.	ELISA	20337701	2010	Pubchem Assay
PRRID_0839	Virulence factor p60 Click for more detail	Listeriamonocytogenes (Bacteria)	MKKIMLVFITLILVSLPIAQQTEAKDASAFNKENSISSMAPPASPPASPKTPIEKKHADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKKKKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTNQDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVNAENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGGSAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVIKNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEVNYDPEGNEIVQHKNWSENNKSKLAHFTSSIYLPGNARNINVYAKECTGLAWEWWRTVIDDRNLPLVKNRNISIWGTTLYPKYSNKVDNPIE	529	Protein	Natural	It activates of nuclear factor kB (NF-kB) and induces proinflammatory cytokine production.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Macropahes	LRR	Q9QUK6.fasta	Q9QUK6	835	It provides host resistance against infection with L. monocytogenes.	ELISA	20337701	2010	Pubchem Assay
PRRID_0840	Virulence factor p60 Click for more detail	Listeriamonocytogenes (Bacteria)	MKKIMLVFITLILVSLPIAQQTEAKDASAFNKENSISSMAPPASPPASPKTPIEKKHADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKKKKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTNQDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVNAENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGGSAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVIKNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEVNYDPEGNEIVQHKNWSENNKSKLAHFTSSIYLPGNARNINVYAKECTGLAWEWWRTVIDDRNLPLVKNRNISIWGTTLYPKYSNKVDNPIE	529	Protein	Natural	It activates of nuclear factor kB (NF-kB) and induces proinflammatory cytokine production.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Macrophage RAW264.7 cells	LRR	Q9QUK6.fasta	Q9QUK6	835	It provides host resistance against infection with L. monocytogenes.	ELISA	20337701	2010	Pubchem Assay
PRRID_0840	Virulence factor p60 Click for more detail	Listeriamonocytogenes (Bacteria)	MKKIMLVFITLILVSLPIAQQTEAKDASAFNKENSISSMAPPASPPASPKTPIEKKHADEIDKYIQGLDYNKNNVLVYHGDAVTNVPPRKGYKDGNEYIVVEKKKKSINQNNADIQVVNAISSLTYPGALVKANSELVENQPDVLPVKRDSLTLSIDLPGMTNQDNKIVVKNATKSNVNNAVNTLVERWNEKYAQAYPNVSAKIDYDDEMAYSESQLIAKFGTAFKAVNNSLNVNFGAISEGKMQEEVISFKQIYYNVNVNEPTRPSRFFGKAVTKEQLQALGVNAENPPAYISSVAYGRQVYLKLSTNSHSTKVKAAFDAAVSGKSVSGDVELTNIIKNSSFKAVIYGGSAKDEVQIIDGNLGDLRDILKKGATFNRETPGVPIAYTTNFLKDNELAVIKNNSEYIETTSKAYTDGKINIDHSGGYVAQFNISWDEVNYDPEGNEIVQHKNWSENNKSKLAHFTSSIYLPGNARNINVYAKECTGLAWEWWRTVIDDRNLPLVKNRNISIWGTTLYPKYSNKVDNPIE	529	Protein	Natural	It activates of nuclear factor kB (NF-kB) and induces proinflammatory cytokine production.	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Mice	Macrophage RAW264.7 cells	LRR	Q9QUK6.fasta	Q9QUK6	835	It provides host resistance against infection with L. monocytogenes.	ELISA	20337701	2010	Pubchem Assay
PRRID_0841	Virus Click for more detail	T. gondii (others)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	It induces Crp-3/-5 production and release by PCs via a TLR9-dependent production of type I IFNs	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	C57BL/6 Mice	epithial cells	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	It affect the early control of T. gondii invasiveness by promoting the initiation of a protective Th1 response against the parasite	NA	20488791	2010	Pubchem Assay
PRRID_0841	Virus Click for more detail	T. gondii (others)	NA	NA	Pattern-associated molecular patterns (PAMPs)	Natural	It induces Crp-3/-5 production and release by PCs via a TLR9-dependent production of type I IFNs	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	C57BL/6 Mice	epithial cells	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	It affect the early control of T. gondii invasiveness by promoting the initiation of a protective Th1 response against the parasite	NA	20488791	2010	Pubchem Assay
PRRID_0842	Vpr Click for more detail	HIV-1 (virus)	MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGVTQQRRARNGASRS	96	Protein	Natural	Activate NF-Œ∫B	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Enhance IL-6, IL-8, and IL-10 production	NA	20672047	2010	NA
PRRID_0842	Vpr Click for more detail	HIV-1 (virus)	MEQAPEDQGPQREPHNEWTLELLEELKNEAVRHFPRIWLHGLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGVTQQRRARNGASRS	96	Protein	Natural	Activate NF-Œ∫B	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Enhance IL-6, IL-8, and IL-10 production	NA	20672047	2010	NA
PRRID_0843	Vpu Click for more detail	HIV-1 (virus)	MQPIQIAIAALVVAIIIAIVVWSIVIIEYRKILRQRKIDRLIDRLIERAEDSGNESEGEISALVEMGVEMGHHAPWDIDDL	81	Protein	Natural	Inhibit NF-Œ∫B activation (Stabilize IŒ∫B)	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Suppress cytokine production	NA	20672047	2010	NA
PRRID_0843	Vpu Click for more detail	HIV-1 (virus)	MQPIQIAIAALVVAIIIAIVVWSIVIIEYRKILRQRKIDRLIDRLIERAEDSGNESEGEISALVEMGVEMGHHAPWDIDDL	81	Protein	Natural	Inhibit NF-Œ∫B activation (Stabilize IŒ∫B)	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Suppress cytokine production	NA	20672047	2010	NA
PRRID_0844	Whole bacteria Click for more detail	Legionella pneumophila (Bacteria)	NA	NA	Whole organism	Natural	It activates the p38 MAPK and JNK as well as recruitment of NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Primary human small airway epithelial cells (SAEC)	LRR	O60603.fasta	O60603	784	hBD-2 elicits an antimicrobial effect on L. pneumophila.	ELISA	20154223	2010	Pubchem Assay
PRRID_0844	Whole bacteria Click for more detail	Legionella pneumophila (Bacteria)	NA	NA	Whole organism	Natural	It activates the p38 MAPK and JNK as well as recruitment of NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Primary human small airway epithelial cells (SAEC)	LRR	O60603.fasta	O60603	784	hBD-2 elicits an antimicrobial effect on L. pneumophila.	ELISA	20154223	2010	Pubchem Assay
PRRID_0845	Whole bacteria Click for more detail	Legionella pneumophila (Bacteria)	NA	NA	Whole organism	Natural	It activates the p38 MAPK and JNK as well as recruitment of NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Primary human small airway epithelial cells (SAEC)	LRR	O60603.fasta	O60603	784	hBD-2 elicits an antimicrobial effect on L. pneumophila.	ELISA	20154223	2010	Pubchem Assay
PRRID_0845	Whole bacteria Click for more detail	Legionella pneumophila (Bacteria)	NA	NA	Whole organism	Natural	It activates the p38 MAPK and JNK as well as recruitment of NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Primary human small airway epithelial cells (SAEC)	LRR	O60603.fasta	O60603	784	hBD-2 elicits an antimicrobial effect on L. pneumophila.	ELISA	20154223	2010	Pubchem Assay
PRRID_0846	Xanthine oxidase Click for more detail	NA	NA	NA	Endogenous	Natural	xanthine oxidase can bind to TLR4 and that superoxide must be delivered by xanthine oxidase in close proximity to TLR4 in order to activate neutrophils	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	NA	neutrohils	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	This binding of Xanthine oxidase brings superoxides in close proximity to TLR4, which leads to production of proinflammatory cytokines in case of ischemia‚Äìreperfusion injury	NA	20689929	2010	NA
PRRID_0846	Xanthine oxidase Click for more detail	NA	NA	NA	Endogenous	Natural	xanthine oxidase can bind to TLR4 and that superoxide must be delivered by xanthine oxidase in close proximity to TLR4 in order to activate neutrophils	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	NA	neutrohils	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	This binding of Xanthine oxidase brings superoxides in close proximity to TLR4, which leads to production of proinflammatory cytokines in case of ischemia‚Äìreperfusion injury	NA	20689929	2010	NA
PRRID_0847	Zymosan Click for more detail	Fungi	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins	Toll-like receptor 2 (TLR2)-Toll-like receptor 6 (TLR6) dimer	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It coauses the inflammation	NA	20740341	2010	NA
PRRID_0847	Zymosan Click for more detail	Fungi	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	Activates NF-KB and MAPK which lead to the production of cytokines as TNF and other proinflammatory proteins	Toll-like receptor 2 (TLR2)-Toll-like receptor 6 (TLR6) dimer	Toll-like receptor (TLR)	Human	NA	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It coauses the inflammation	NA	20740341	2010	NA
PRRID_0848	Zymosan Click for more detail	Fungi	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	dendritic cells, macrophages and lymphocytes	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	NA	NA	20713100	2010	Pubchem Assay
PRRID_0848	Zymosan Click for more detail	Fungi	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	NA	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	dendritic cells, macrophages and lymphocytes	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	NA	NA	20713100	2010	Pubchem Assay
PRRID_0849	Zymosan Click for more detail	Fungi	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	Increases expression of macrophage inflammatory protein-2 , cytokine migration inhibitory factor (MIF), and TNF-Œ± and induces augment PMN migration.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Lung's endothelial cell	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It has the role in the inflammation.	NA	20706658	2010	Pubchem Assay
PRRID_0849	Zymosan Click for more detail	Fungi	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	Increases expression of macrophage inflammatory protein-2 , cytokine migration inhibitory factor (MIF), and TNF-Œ± and induces augment PMN migration.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Lung's endothelial cell	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It has the role in the inflammation.	NA	20706658	2010	Pubchem Assay
PRRID_0850	Zymosan Click for more detail	gram-positive bacteria and yeast	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	Their bindng leads to the secretion of the proinflammatory cytokines through NF-KB pathways	Toll-like receptor 2/6 (TLR2/6)	Toll-like receptor (TLR)	Human	cerebral endothelial cell line hCMEC/D3	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It's activation causes tight junction disruption in CECs	NA	20637248	2010	NA
PRRID_0850	Zymosan Click for more detail	gram-positive bacteria and yeast	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	Their bindng leads to the secretion of the proinflammatory cytokines through NF-KB pathways	Toll-like receptor 2/6 (TLR2/6)	Toll-like receptor (TLR)	Human	cerebral endothelial cell line hCMEC/D3	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	It's activation causes tight junction disruption in CECs	NA	20637248	2010	NA
PRRID_0851	Zymosan Click for more detail	S. cerevisiae (Bacteria)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD88,/TIRAP and aloow the rerutiment of downstream effector	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	Cell surface	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	It leadsto the secretion of the proinfalmmatory cytokines	NA	20620129	2010	Pubchem Assay
PRRID_0851	Zymosan Click for more detail	S. cerevisiae (Bacteria)	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Glucan	Natural	Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD88,/TIRAP and aloow the rerutiment of downstream effector	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	Cell surface	Leucine-rich Repeat (LRR) Domain	Q9NR96.fasta	Q9NR96	1032	It leadsto the secretion of the proinfalmmatory cytokines	NA	20620129	2010	Pubchem Assay
PRRID_0863	LTA Click for more detail	Gram-positive bacteria	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Augment cytokines and chemokines expression and promoting enhanced PMN transalveolar migration and exaggerated lung inflammation in response to invading pathogens	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Lung's endothelial cell	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It has the role in the inflammation.	NA	20706658	2010	Pubchem Assay
PRRID_0863	LTA Click for more detail	Gram-positive bacteria	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Pattern-associated molecular patterns (PAMPs)	Natural	Augment cytokines and chemokines expression and promoting enhanced PMN transalveolar migration and exaggerated lung inflammation in response to invading pathogens	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	Lung's endothelial cell	Leucine-rich Repeat (LRR) Domain	Q9QUN7.fasta	Q9QUN7	784	It has the role in the inflammation.	NA	20706658	2010	Pubchem Assay
PRRID_0865	Œ≤-gal dsRNA Click for more detail	NA	NA	NA	Nucleic Acid	Synthetic	Induce type 1 IFN production	Toll-like receptor 3 (TLR3)/Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	PBMCs	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Immunostimulation	NA	20692289	2010	NA
PRRID_0865	Œ≤-gal dsRNA Click for more detail	NA	NA	NA	Nucleic Acid	Synthetic	Induce type 1 IFN production	Toll-like receptor 3 (TLR3)/Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	PBMCs	Leucine-rich Repeat (LRR) Domain	NA	NA	NA	Immunostimulation	NA	20692289	2010	NA
PRRID_0866	Œ≤2-Glycoprotein I (Œ≤2-gpI) Click for more detail	Human (others)	NA	NA	Glycoprotein	Natural	It triggers the downstream phosphorylation of kinases and activation of NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Endothelial cells	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It recruits the MyD88 adapter protein and lead to the production of proinflammatory cytokines	Reporter gene assay	20601596	2010	Pubchem Assay
PRRID_0866	Œ≤2-Glycoprotein I (Œ≤2-gpI) Click for more detail	Human (others)	NA	NA	Glycoprotein	Natural	It triggers the downstream phosphorylation of kinases and activation of NF-	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	Endothelial cells	Leucine-rich Repeat (LRR) Domain	O60603.fasta	O60603	784	It recruits the MyD88 adapter protein and lead to the production of proinflammatory cytokines	Reporter gene assay	20601596	2010	Pubchem Assay

previous 1 2...8 9 101112 13 14...69 70 next