| Primary information |
|---|
| PRRID | PRRID_0811 |
| Ligand Name | Stathmins |
| Source | Human (others) |
| Sequence of ligand | MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD |
| Length | 149 |
| Type | Endogenous |
| Occurence | Natural |
| Role of Ligand | Binding of stathmins to TLR3 activates downstream signalling pathways via TRIF and lead to the secretion of IL-6 and CXCL-8 |
| Name of receptor | Toll-like receptor 3 (TLR3) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice (Murine) |
| Localization | Astrocytes and microglia |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | Q99MB1.fasta |
| Swiss prot ID | Q99MB1 |
| Length Of Receptor | 905 |
| Function | It has a role in astrocyte-mediated neuroprotection and in morphogenesis in the CNS |
| Assay used | NA |
| PMID | 20483774 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |
| Primary information |
|---|
| PRRID | PRRID_0811 |
| Ligand Name | Stathmins |
| Source | Human (others) |
| Sequence of ligand | MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD |
| Length | 149 |
| Type | Endogenous |
| Occurence | Natural |
| Role of Ligand | Binding of stathmins to TLR3 activates downstream signalling pathways via TRIF and lead to the secretion of IL-6 and CXCL-8 |
| Name of receptor | Toll-like receptor 3 (TLR3) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice (Murine) |
| Localization | Astrocytes and microglia |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | Q99MB1.fasta |
| Swiss prot ID | Q99MB1 |
| Length Of Receptor | 905 |
| Function | It has a role in astrocyte-mediated neuroprotection and in morphogenesis in the CNS |
| Assay used | NA |
| PMID | 20483774 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |