| Primary information |
|---|
| PRRID | PRRID_0748 |
| Ligand Name | phenol-soluble modulin |
| Source | Staphylococcus epidermis (Bacteria) |
| Sequence of ligand | MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFGF |
| Length | 44 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | Increases expression of macrophage inflammatory protein-2 , cytokine migration inhibitory factor (MIF), and TNF-α and induces augment PMN migration. |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | Lung's endothelial cell |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | Q9QUN7.fasta |
| Swiss prot ID | Q9QUN7 |
| Length Of Receptor | 784 |
| Function | It has the role in the inflammation. |
| Assay used | NA |
| PMID | 20706658 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |
| Primary information |
|---|
| PRRID | PRRID_0748 |
| Ligand Name | phenol-soluble modulin |
| Source | Staphylococcus epidermis (Bacteria) |
| Sequence of ligand | MSKLAEAIANTVKAAQDQDWTKLGTSIVDIVESGVSVLGKIFGF |
| Length | 44 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | Increases expression of macrophage inflammatory protein-2 , cytokine migration inhibitory factor (MIF), and TNF-α and induces augment PMN migration. |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | Lung's endothelial cell |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | Q9QUN7.fasta |
| Swiss prot ID | Q9QUN7 |
| Length Of Receptor | 784 |
| Function | It has the role in the inflammation. |
| Assay used | NA |
| PMID | 20706658 |
| Year of Publication | 2010 |
| Pubchem assay | Pubchem Assay |