Browse result page of PRRDB 2.0

PRRID	Name of Ligand	Source of ligand	Sequence of Ligand	Length of Ligand	Type of Ligand	Occurence	Role of Ligand	Name of Receptor	Type of Reeptor	Source of the Receptor	Localization	Domain	Sequence of Receptor	Swiss prot ID	Length of receptor	Function of Receptor	Assay used	PMID	Year of publication	Pubchem assay
PRRID_1506	NACHT Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	TRIM27	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1506	NACHT Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	TRIM27	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1507	NACHT-LRR Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	MAVS	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1507	NACHT-LRR Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	MAVS	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1509	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	NA	VIP36	Pattern recognition receptor (PRR)	NA	NA	NA	NA	NA	NA	NA	NA	24796868	2014	NA
PRRID_1509	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	NA	VIP36	Pattern recognition receptor (PRR)	NA	NA	NA	NA	NA	NA	NA	NA	24796868	2014	NA
PRRID_1510	D-mannose Click for more detail	Bacteria	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Carbohydrate	Natural	NA	VIP36	Pattern recognition receptor (PRR)	NA	NA	NA	NA	NA	NA	NA	NA	24796868	2014	NA
PRRID_1510	D-mannose Click for more detail	Bacteria	C(C1C(C(C(C(O1)O)O)O)O)O	NA	Carbohydrate	Natural	NA	VIP36	Pattern recognition receptor (PRR)	NA	NA	NA	NA	NA	NA	NA	NA	24796868	2014	NA
PRRID_1511	Acetyl-D-mannosamine Click for more detail	Bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Protein	Natural	NA	VIP36	Pattern recognition receptor (PRR)	NA	NA	NA	NA	NA	NA	NA	NA	24796868	2014	NA
PRRID_1511	Acetyl-D-mannosamine Click for more detail	Bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Protein	Natural	NA	VIP36	Pattern recognition receptor (PRR)	NA	NA	NA	NA	NA	NA	NA	NA	24796868	2014	NA
PRRID_1512	NACHT Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	AAMP	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1512	NACHT Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	AAMP	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1514	Non-methylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	extracellular domains of leucine-rich repeat motifs	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	NA	24754320	2014	Pubchem_assay
PRRID_1514	Non-methylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	extracellular domains of leucine-rich repeat motifs	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	NA	24754320	2014	Pubchem_assay
PRRID_1515	Non-methylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	extracellular domains of leucine-rich repeat motifs	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	NA	24754320	2014	Pubchem_assay
PRRID_1515	Non-methylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Natural	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	extracellular domains of leucine-rich repeat motifs	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	NA	24754320	2014	Pubchem_assay
PRRID_1516	non-methylated cytosine‚Äìguanine dinucleotide (Cg) motifs Click for more detail	Bacterial, viral and mitochondrial Dna	NA	NA	Nucleic Acid	Natural	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human patients with metastatic colorectal carcinoma (CRC)	plasmacytoid dendritic cells (pDC) and B cells	cell compartment	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	NA	24816725	2014	Pubchem_assay
PRRID_1516	non-methylated cytosine‚Äìguanine dinucleotide (Cg) motifs Click for more detail	Bacterial, viral and mitochondrial Dna	NA	NA	Nucleic Acid	Natural	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human patients with metastatic colorectal carcinoma (CRC)	plasmacytoid dendritic cells (pDC) and B cells	cell compartment	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	NA	24816725	2014	Pubchem_assay
PRRID_1517	ODN2006 Click for more detail	Bacteria	5‚Äô-tcgtcgttttgtcgttttgtcgtt-3‚Äô	24	Pattern-associated molecular patterns (PAMPs)	Synthetic	induce strong immunostimulatory effects trough activation of TLR9 in mammalian cells and type B CpG ODN2006 significantly induced IL-1b and IFN-a1	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	dendritic cells, macrophages, natural killer cells	NA	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	Real-time PCR	24736205	2014	Pubchem_assay
PRRID_1517	ODN2006 Click for more detail	Bacteria	5‚Äô-tcgtcgttttgtcgttttgtcgtt-3‚Äô	24	Pattern-associated molecular patterns (PAMPs)	Synthetic	induce strong immunostimulatory effects trough activation of TLR9 in mammalian cells and type B CpG ODN2006 significantly induced IL-1b and IFN-a1	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	dendritic cells, macrophages, natural killer cells	NA	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	Real-time PCR	24736205	2014	Pubchem_assay
PRRID_1521	Pam3 Click for more detail	Bacteria	NA	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor 2/1 (TLR2/1)	Toll-like receptor (TLR)	European and African Children	NA	MyD88	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	ELISA	24743542	2014	NA
PRRID_1521	Pam3 Click for more detail	Bacteria	NA	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor 2/1 (TLR2/1)	Toll-like receptor (TLR)	European and African Children	NA	MyD88	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	ELISA	24743542	2014	NA
PRRID_1522	Pam3CSK3 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipopeptides	Synthetic	mimic parts of bacterial lipoproteins	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	NA	NA	NA	NA	NA	TLR2 forms a heterodimer with TLR1 in response to Pam3CSK4 leading to the recruitment of the adaptor proteins MAL and MYD88 and the activation of IL1 receptor-associated kinase 4 (IRAK4), IRAK1, and TNF receptor-associated factor 6	Real-time PCR	24736205	2014	NA
PRRID_1522	Pam3CSK3 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipopeptides	Synthetic	mimic parts of bacterial lipoproteins	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	NA	NA	NA	NA	NA	TLR2 forms a heterodimer with TLR1 in response to Pam3CSK4 leading to the recruitment of the adaptor proteins MAL and MYD88 and the activation of IL1 receptor-associated kinase 4 (IRAK4), IRAK1, and TNF receptor-associated factor 6	Real-time PCR	24736205	2014	NA
PRRID_1523	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	Mimics the acylated amino terminus of bacterial LPs and is a potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs and B-lymphocytes	Cell Surface (Exogenous)	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	NA	24830024	2014	NA
PRRID_1523	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	Mimics the acylated amino terminus of bacterial LPs and is a potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs and B-lymphocytes	Cell Surface (Exogenous)	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	NA	24830024	2014	NA
PRRID_1524	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	Mimics the acylated amino terminus of bacterial LPs and is a potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs and B-lymphocytes	Cell Surface (Exogenous)	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	NA	24830024	2014	NA
PRRID_1524	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	Mimics the acylated amino terminus of bacterial LPs and is a potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs and B-lymphocytes	Cell Surface (Exogenous)	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	NA	24830024	2014	NA
PRRID_1526	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	increases the immunogenicity of B- cell lymphoma cells and alters their trafficking pattern when combined with the genotoxic anticancer drug 1-b-D-arabinofuranosylcytosine.	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Em-Myc Mice (a Mouse model for Human Burkitt lymphoma and non-Hodgkin lymphomas)	B-cell lymphoma cell lines	cell surface	NA	NA	NA	TLR2 forms a heterodimer with TLR1 in response to Pam3CSK4 leading to the recruitment of the adaptor proteins MAL and MYD88 and the activation of IL1 receptor-associated kinase 4 (IRAK4), IRAK1, and TNF receptor-associated factor 6	ELISA	24799523	2014	NA
PRRID_1526	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	increases the immunogenicity of B- cell lymphoma cells and alters their trafficking pattern when combined with the genotoxic anticancer drug 1-b-D-arabinofuranosylcytosine.	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Em-Myc Mice (a Mouse model for Human Burkitt lymphoma and non-Hodgkin lymphomas)	B-cell lymphoma cell lines	cell surface	NA	NA	NA	TLR2 forms a heterodimer with TLR1 in response to Pam3CSK4 leading to the recruitment of the adaptor proteins MAL and MYD88 and the activation of IL1 receptor-associated kinase 4 (IRAK4), IRAK1, and TNF receptor-associated factor 6	ELISA	24799523	2014	NA
PRRID_1527	Pam3CSK4 Click for more detail	Salmonella typhimurium(Bacteria)	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipopeptides	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Chicken	splenocytes	cell surface	Q9DD78.fasta	Q9DD78	793	TLR2 and TLR5 promote cellular activation and the production of cytokines including proinflammatory interleukin (IL)-6, as well as those cytokines that help to initiate and modulate the adaptive immune response, including IL-4, IL-12, and interferon (IFN)-c	ELISA	24797722	2014	Pubchem_assay
PRRID_1527	Pam3CSK4 Click for more detail	Salmonella typhimurium(Bacteria)	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipopeptides	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Chicken	splenocytes	cell surface	Q9DD78.fasta	Q9DD78	793	TLR2 and TLR5 promote cellular activation and the production of cytokines including proinflammatory interleukin (IL)-6, as well as those cytokines that help to initiate and modulate the adaptive immune response, including IL-4, IL-12, and interferon (IFN)-c	ELISA	24797722	2014	Pubchem_assay
PRRID_1528	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipopeptides	Synthetic	induce apoptosis in monocytes	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	bone marrow stromal cells (BMSCs)	cell surface	NA	NA	NA	TLR1/2 triggering may be of therapeutic use to decrease cellular resistance to the cytotoxic action of chemotherapeutic agents.	Fluorometric Adhesion Assay, Drug Cytotoxicity Assay, Apoptosis Assay	24794258	2014	NA
PRRID_1528	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipopeptides	Synthetic	induce apoptosis in monocytes	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	bone marrow stromal cells (BMSCs)	cell surface	NA	NA	NA	TLR1/2 triggering may be of therapeutic use to decrease cellular resistance to the cytotoxic action of chemotherapeutic agents.	Fluorometric Adhesion Assay, Drug Cytotoxicity Assay, Apoptosis Assay	24794258	2014	NA
PRRID_1529	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages	cell surface	Q9QUN7.fasta	Q9QUN7	784	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24771854	2014	Pubchem_assay
PRRID_1529	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages	cell surface	Q9QUN7.fasta	Q9QUN7	784	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24771854	2014	Pubchem_assay
PRRID_1530	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages	cell surface	O60603.fasta	O60603	784	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24771854	2014	Pubchem_assay
PRRID_1530	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages	cell surface	O60603.fasta	O60603	784	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24771854	2014	Pubchem_assay
PRRID_1531	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages	cell surface	NA	NA	NA	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24771328	2014	NA
PRRID_1531	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages	cell surface	NA	NA	NA	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24771328	2014	NA
PRRID_1532	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages	cell surface	NA	NA	NA	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24771328	2014	NA
PRRID_1532	Pam3CSK4 Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)NC(CO)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)NC(CCCCN)C(=O)O	NA	Lipoprotein	Synthetic	triacylated lipopeptide potent activator of the proinflammatory transcription factor NF-Œ∫B.	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages	cell surface	NA	NA	NA	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24771328	2014	NA
PRRID_1542	Peptidoglycan (PGN) Click for more detail	cell wall of Gram-positive bacteria(Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	PGN is known to be a potent activator of NF-Œ∫B and TNF-Œ± through TLR2	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	cell surface	Q9QUN7.fasta	Q9QUN7	784	significant role in the pathogenesis of severe inflammatory responses	Histological analyses, Real-time PCR analysis, Western blotting	24815695	2014	Pubchem_assay
PRRID_1542	Peptidoglycan (PGN) Click for more detail	cell wall of Gram-positive bacteria(Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	PGN is known to be a potent activator of NF-Œ∫B and TNF-Œ± through TLR2	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	cell surface	Q9QUN7.fasta	Q9QUN7	784	significant role in the pathogenesis of severe inflammatory responses	Histological analyses, Real-time PCR analysis, Western blotting	24815695	2014	Pubchem_assay
PRRID_1546	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Chicken	splenocytes	cell surface	Q9DD78.fasta	Q9DD78	793	TLR2 and TLR5 promote cellular activation and the production of cytokines including proinflammatory interleukin (IL)-6, as well as those cytokines that help to initiate and modulate the adaptive immune response, including IL-4, IL-12, and interferon (IFN)-c	ELISA	24797722	2014	Pubchem_assay
PRRID_1546	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Chicken	splenocytes	cell surface	Q9DD78.fasta	Q9DD78	793	TLR2 and TLR5 promote cellular activation and the production of cytokines including proinflammatory interleukin (IL)-6, as well as those cytokines that help to initiate and modulate the adaptive immune response, including IL-4, IL-12, and interferon (IFN)-c	ELISA	24797722	2014	Pubchem_assay
PRRID_1547	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	elicit innate immune response	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	peripheral blood mononuclear cells such as macrophages, granulocytes, dendritic cells, and along the intestinal epithelial cells	intracellular receptors	Q9HC29.fasta	Q9HC29	1040	recognizes fragments of the bacterial cell wall.	Luciferase assay	24790089	2014	Pubchem_assay
PRRID_1547	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	elicit innate immune response	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	peripheral blood mononuclear cells such as macrophages, granulocytes, dendritic cells, and along the intestinal epithelial cells	intracellular receptors	Q9HC29.fasta	Q9HC29	1040	recognizes fragments of the bacterial cell wall.	Luciferase assay	24790089	2014	Pubchem_assay
PRRID_1548	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	triggers immune responses	Nod-like receptor 1 (NLR1)	NOD-like receptor (NLR)	Mice	lymphocytes, macrophages, dendritic cells	intracellular receptors	NA	NA	NA	triggering of these receptors induces activation of the NF-Œ∫B pathway and consequently, an immune response	NA	24779390	2014	NA
PRRID_1548	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	triggers immune responses	Nod-like receptor 1 (NLR1)	NOD-like receptor (NLR)	Mice	lymphocytes, macrophages, dendritic cells	intracellular receptors	NA	NA	NA	triggering of these receptors induces activation of the NF-Œ∫B pathway and consequently, an immune response	NA	24779390	2014	NA
PRRID_1549	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	triggers immune responses	PGN-binding proteins (PGRPs)	Peptidoglycan Recognition Receptor (PGRPs)	Mice	lymphocytes, macrophages, dendritic cells	intracellular receptors	NA	NA	NA	triggering of these receptors induces activation of the NF-Œ∫B pathway and consequently, an immune response	NA	24779390	2014	NA
PRRID_1549	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	triggers immune responses	PGN-binding proteins (PGRPs)	Peptidoglycan Recognition Receptor (PGRPs)	Mice	lymphocytes, macrophages, dendritic cells	intracellular receptors	NA	NA	NA	triggering of these receptors induces activation of the NF-Œ∫B pathway and consequently, an immune response	NA	24779390	2014	NA
PRRID_1550	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	triggers immune responses	Nod-like receptor 1 (NLR1)	NOD-like receptor (NLR)	Human	lymphocytes, macrophages, dendritic cells	intracellular receptors	NA	NA	NA	triggering of these receptors induces activation of the NF-Œ∫B pathway and consequently, an immune response	NA	24779390	2014	NA
PRRID_1550	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	triggers immune responses	Nod-like receptor 1 (NLR1)	NOD-like receptor (NLR)	Human	lymphocytes, macrophages, dendritic cells	intracellular receptors	NA	NA	NA	triggering of these receptors induces activation of the NF-Œ∫B pathway and consequently, an immune response	NA	24779390	2014	NA
PRRID_1551	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	triggers immune responses	PGN-binding proteins (PGRPs)	Peptidoglycan Recognition Receptor (PGRPs)	Human	lymphocytes, macrophages, dendritic cells	intracellular receptors	NA	NA	NA	triggering of these receptors induces activation of the NF-Œ∫B pathway and consequently, an immune response	NA	24779390	2014	NA
PRRID_1551	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	triggers immune responses	PGN-binding proteins (PGRPs)	Peptidoglycan Recognition Receptor (PGRPs)	Human	lymphocytes, macrophages, dendritic cells	intracellular receptors	NA	NA	NA	triggering of these receptors induces activation of the NF-Œ∫B pathway and consequently, an immune response	NA	24779390	2014	NA
PRRID_1554	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	NA	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1554	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	NA	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1555	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	NA	MjFREP2	FREP	NA	NA	NA	NA	NA	NA	NA	NA	24830772	2014	NA
PRRID_1555	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	NA	MjFREP2	FREP	NA	NA	NA	NA	NA	NA	NA	NA	24830772	2014	NA
PRRID_1556	Peptidoglycan (PGN) Click for more detail	Gram negative Bacteria (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domain with leucine-rich repeats and a conservative intracellular Toll/IL- 1 receptor (TIR) domain	Q9QUN7.fasta	Q9QUN7	784	significant role in the pathogenesis of severe inflammatory responses	ELISA	24757287	2014	Pubchem_assay
PRRID_1556	Peptidoglycan (PGN) Click for more detail	Gram negative Bacteria (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domain with leucine-rich repeats and a conservative intracellular Toll/IL- 1 receptor (TIR) domain	Q9QUN7.fasta	Q9QUN7	784	significant role in the pathogenesis of severe inflammatory responses	ELISA	24757287	2014	Pubchem_assay
PRRID_1557	Peptidoglycan (PGN) Click for more detail	Gram negative Bacteria (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domain with leucine-rich repeats and a conservative intracellular Toll/IL- 1 receptor (TIR) domain	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	ELISA	24757287	2014	Pubchem_assay
PRRID_1557	Peptidoglycan (PGN) Click for more detail	Gram negative Bacteria (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domain with leucine-rich repeats and a conservative intracellular Toll/IL- 1 receptor (TIR) domain	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	ELISA	24757287	2014	Pubchem_assay
PRRID_1558	Peptidoglycan (PGN) Click for more detail	Gram negative Bacteria (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	triggers immune responses	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domains of leucine-rich repeat motifs	Q9QUN7.fasta	Q9QUN7	784	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	Pubchem_assay
PRRID_1558	Peptidoglycan (PGN) Click for more detail	Gram negative Bacteria (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	triggers immune responses	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domains of leucine-rich repeat motifs	Q9QUN7.fasta	Q9QUN7	784	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	Pubchem_assay
PRRID_1559	Peptidoglycan (PGN) Click for more detail	Gram negative Bacteria (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	triggers immune responses	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domains of leucine-rich repeat motifs	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	Pubchem_assay
PRRID_1559	Peptidoglycan (PGN) Click for more detail	Gram negative Bacteria (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	triggers immune responses	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domains of leucine-rich repeat motifs	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	Pubchem_assay
PRRID_1560	Peptidoglycan (PGN) Click for more detail	Gram negative Bacteria (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	elicit innate immune response	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	European and African Children	most adult tissues	signals via a caspase- activated recruitment domain (CARD)	Q9Y239.fasta	Q9Y239	953	induce autophagy and inflammatory responses in host cells.	ELISA	24746552	2014	Pubchem_assay
PRRID_1560	Peptidoglycan (PGN) Click for more detail	Gram negative Bacteria (Bacteria)	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	elicit innate immune response	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	European and African Children	most adult tissues	signals via a caspase- activated recruitment domain (CARD)	Q9Y239.fasta	Q9Y239	953	induce autophagy and inflammatory responses in host cells.	ELISA	24746552	2014	Pubchem_assay
PRRID_1563	CARDs Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1563	CARDs Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	Nod-like receptor P3 (NLRP3)	NOD-like receptor (NLR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1564	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	NA	PGN-binding proteins (PGRPs)	Peptidoglycan Recognition Receptor (PGRPs)	NA	NA	NA	NA	NA	NA	NA	NA	23796791	2014	NA
PRRID_1564	Peptidoglycan (PGN) Click for more detail	Bacteria	CC(C(=O)O)OC1C(C(OC(C1O)CO)O)N	NA	Peptidoglycan	Natural	NA	PGN-binding proteins (PGRPs)	Peptidoglycan Recognition Receptor (PGRPs)	NA	NA	NA	NA	NA	NA	NA	NA	23796791	2014	NA
PRRID_1565	phosphorothioated unmethylated CpG-ODNs (Oligodeoxynucleotide) Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	CpG ODN induces class switching to isotypes IgG2a, IgG2b and IgG3 in mice, while suppressing the production of the IgG1 and IgE isotypes; furthermore, it stimulates class switching from IgM to the more pathogenic IgG1, IgG2 and IgG3 in human	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	B-Lymphocytes	Toll-IL-1R (TIR) domain	Q9NR96.fasta	Q9NR96	1032	induces pro-inflammatory cytokine response	NA	24801688	2014	Pubchem_assay
PRRID_1565	phosphorothioated unmethylated CpG-ODNs (Oligodeoxynucleotide) Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	CpG ODN induces class switching to isotypes IgG2a, IgG2b and IgG3 in mice, while suppressing the production of the IgG1 and IgE isotypes; furthermore, it stimulates class switching from IgM to the more pathogenic IgG1, IgG2 and IgG3 in human	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	B-Lymphocytes	Toll-IL-1R (TIR) domain	Q9NR96.fasta	Q9NR96	1032	induces pro-inflammatory cytokine response	NA	24801688	2014	Pubchem_assay
PRRID_1566	phosphorothioated unmethylated CpG-ODNs (Oligodeoxynucleotide) Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	CpG ODN induces class switching to isotypes IgG2a, IgG2b and IgG3 in mice, while suppressing the production of the IgG1 and IgE isotypes; furthermore, it stimulates class switching from IgM to the more pathogenic IgG1, IgG2 and IgG3 in human	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	B-Lymphocytes	Toll-IL-1R (TIR) domain	Q9NR96.fasta	Q9NR96	1032	induces pro-inflammatory cytokine response	NA	24801688	2014	Pubchem_assay
PRRID_1566	phosphorothioated unmethylated CpG-ODNs (Oligodeoxynucleotide) Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	CpG ODN induces class switching to isotypes IgG2a, IgG2b and IgG3 in mice, while suppressing the production of the IgG1 and IgE isotypes; furthermore, it stimulates class switching from IgM to the more pathogenic IgG1, IgG2 and IgG3 in human	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	B-Lymphocytes	Toll-IL-1R (TIR) domain	Q9NR96.fasta	Q9NR96	1032	induces pro-inflammatory cytokine response	NA	24801688	2014	Pubchem_assay
PRRID_1590	polysaccharides (MAMPs) Click for more detail	Bacteria	NA	NA	Carbohydrate	Natural	NA	Calnexin (Cnx)	Pattern recognition receptor (PRR)	Marsupenaeus japonicus	transmembrane chaperone	NA	NA	NA	NA	NA	NA	24858031	2014	NA
PRRID_1590	polysaccharides (MAMPs) Click for more detail	Bacteria	NA	NA	Carbohydrate	Natural	NA	Calnexin (Cnx)	Pattern recognition receptor (PRR)	Marsupenaeus japonicus	transmembrane chaperone	NA	NA	NA	NA	NA	NA	24858031	2014	NA
PRRID_1610	S100A12 Click for more detail	Bacteria	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Protein	Natural	NA	Soluble RAGE (sRAGE)	Receptor for advanced glycation endproducts (RAGE)	NA	NA	NA	NA	NA	NA	NA	NA	25183017	2014	NA
PRRID_1610	S100A12 Click for more detail	Bacteria	MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE	92	Protein	Natural	NA	Soluble RAGE (sRAGE)	Receptor for advanced glycation endproducts (RAGE)	NA	NA	NA	NA	NA	NA	NA	NA	25183017	2014	NA
PRRID_1646	Tandem CARDs Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	cluster of differentiation 147 (CD147)	Pattern recognition receptor (PRR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1646	Tandem CARDs Click for more detail	Bacteria	NA	NA	Protein	Natural	NA	cluster of differentiation 147 (CD147)	Pattern recognition receptor (PRR)	NA	NA	NA	NA	NA	NA	NA	NA	25520185	2014	NA
PRRID_1652	Triacetylated lipoproteins Click for more detail	Bacteria	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	elicit innate immune response	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs, B-lymphocytes	extracellular domains of leucine-rich repeat motifs	NA	NA	NA	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	NA
PRRID_1652	Triacetylated lipoproteins Click for more detail	Bacteria	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	elicit innate immune response	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs, B-lymphocytes	extracellular domains of leucine-rich repeat motifs	NA	NA	NA	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	NA
PRRID_1653	Triacetylated lipoproteins Click for more detail	Bacteria	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	elicit innate immune response	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs, B-lymphocytes	extracellular domains of leucine-rich repeat motifs	NA	NA	NA	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	NA
PRRID_1653	Triacetylated lipoproteins Click for more detail	Bacteria	CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1	NA	Lipoprotein	Natural	elicit innate immune response	Toll-like receptor 1/2 (TLR1/2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs, B-lymphocytes	extracellular domains of leucine-rich repeat motifs	NA	NA	NA	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	NA
PRRID_1654	Triacylated lipopeptides Click for more detail	Bacteria	NA	NA	Lipopeptides	Natural	elicit innate immune response	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs and B-lymphocytes	Cell Surface (Exogenous)	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	NA	24830024	2014	NA
PRRID_1654	Triacylated lipopeptides Click for more detail	Bacteria	NA	NA	Lipopeptides	Natural	elicit innate immune response	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs and B-lymphocytes	Cell Surface (Exogenous)	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	NA	24830024	2014	NA
PRRID_1655	Triacylated lipopeptides Click for more detail	Bacteria	NA	NA	Lipopeptides	Natural	elicit innate immune response	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs and B-lymphocytes	Cell Surface (Exogenous)	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	NA	24830024	2014	NA
PRRID_1655	Triacylated lipopeptides Click for more detail	Bacteria	NA	NA	Lipopeptides	Natural	elicit innate immune response	Toll-like receptor (TLR1/Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, DCs and B-lymphocytes	Cell Surface (Exogenous)	NA	NA	NA	TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6.	NA	24830024	2014	NA
PRRID_1656	tripalmitoyl-S-glycerol cysteine (Pam3Cys) Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)O	NA	Lipopeptides	Synthetic	provide immunostimulatory activity	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	C57BL/6J mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	Toll/IL-1R (TIR) domain-containing adaptor molecule MyD88 (myeloid differentiation factor 88)-dependent pathway	Q9QUN7.fasta	Q9QUN7	784	significant role in the pathogenesis of severe inflammatory responses	ELISA	24712905	2014	Pubchem_assay
PRRID_1656	tripalmitoyl-S-glycerol cysteine (Pam3Cys) Click for more detail	Bacteria	CCCCCCCCCCCCCCCC(=O)NC(CSCC(COC(=O)CCCCCCCCCCCCCCC)OC(=O)CCCCCCCCCCCCCCC)C(=O)O	NA	Lipopeptides	Synthetic	provide immunostimulatory activity	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	C57BL/6J mice	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	Toll/IL-1R (TIR) domain-containing adaptor molecule MyD88 (myeloid differentiation factor 88)-dependent pathway	Q9QUN7.fasta	Q9QUN7	784	significant role in the pathogenesis of severe inflammatory responses	ELISA	24712905	2014	Pubchem_assay
PRRID_1662	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	Q9NR96.fasta	Q9NR96	1032	induces pro-inflammatory cytokine response	NA	24830024	2014	Pubchem_assay
PRRID_1662	Unmethylated CpG DNA Click for more detail	Bacteria	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	Q9NR96.fasta	Q9NR96	1032	induces pro-inflammatory cytokine response	NA	24830024	2014	Pubchem_assay
PRRID_1663	Unmethylated CpG DNA Click for more detail	Apoptotic cell(Bacteria)	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	ELISPOT assay, Proliferation assay	24828435	2014	Pubchem_assay
PRRID_1663	Unmethylated CpG DNA Click for more detail	Apoptotic cell(Bacteria)	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Mice	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	ELISPOT assay, Proliferation assay	24828435	2014	Pubchem_assay
PRRID_1664	Unmethylated CpG DNA Click for more detail	Apoptotic cell(Bacteria)	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	ELISPOT assay, Proliferation assay	24828435	2014	Pubchem_assay
PRRID_1664	Unmethylated CpG DNA Click for more detail	Apoptotic cell(Bacteria)	NA	NA	Nucleic Acid	Synthetic	act as immuno stimulants	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	Cell Compartment/Intracellular (Endosome)	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	ELISPOT assay, Proliferation assay	24828435	2014	Pubchem_assay

previous 1 2...8 9 101112 13 14...35 36 next