ID | PEPTIDE SEQUENCE | PEPTIDE NAME | LENGTH | CHIRALITY | LINEAR/CYCLIC | SOURCE | CATEGORY | N TERMINAL MODIFICATION | C TERMINAL MODIFICATION | CHEMICAL MODIFICATION | CARGO | PUBMED ID |
---|---|---|---|---|---|---|---|---|---|---|---|---|
2062 | RRRRRRRRRRR | R11 | 11 | L | Linear | Synthetic | NA | Free | Free | Histidine tagged | Nanoparticles [Nanostructured lipid carriers (NLC) and Ibuprofen (Ibu)] | 23187866 |
2063 | YKALRISRKLAK | YKA peptide | 12 | L | Linear | Synthetic | NA | Free | Free | Histidine tagged | Nanoparticles [Nanostructured lipid carriers (NLC) and Ibuprofen (Ibu)] | 23187866 |
2064 | KETWWETWWTEWSQPKKKRKVC | FP-lipo | 22 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticle (Liposomes and folic acid) | 23515421 |
2069 | CVSRRRRRRGGRRRR | LMWP | 15 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticles and Fluoriophore (coumarin-6) | 23350619 |
2070 | EEEEEEEEEE-PLGLAG-VSRRRRRRGGRRRR | ALWMP | 24 | L | Linear | Synthetic | NA | Free | Free | Linker (PLGLAG) | Nanoparticles and Fluoriophore (coumarin-6) | 23350619 |
2122 | AGYLLGHINLHHLAHLHHILC | TH peptide | 21 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticle (Liposomes) | 23891517 |
2123 | AGYLLGHINLHHLAHLHHIL | TH peptide | 20 | L | Linear | Synthetic | Cationic | Free | Amidation | NA | Nanoparticle (Liposomes) | 23891517 |
2124 | AGYLLGKINLKKLAKLLLIL | TK peptide | 20 | L | Linear | Synthetic | Cationic | Free | Amidation | NA | Nanoparticle (Liposomes) | 23891517 |
2167 | CSKSSDYQC | CSK | 9 | L | Cyclic | Synthetic | NA | Free | Free | Coupling to polyoxyethylene (40) steartae (SA-PEG2000) | Nanoparticle [salmon calcitonin (sCT)-loaded SLNs (Solid Lipid Nanoparticle)] | 24968819 |
2168 | IRQRRRR | IRQ | 7 | L | Linear | Synthetic | Cationic | Free | Free | Coupling to polyoxyethylene (40) steartae (SA-PEG2000) | Nanoparticle [salmon calcitonin (sCT)-loaded SLNs (Solid Lipid Nanoparticle)] | 24968819 |
2170 | VSRRRRRRGGRRRR | C24-LMWP | 14 | L | Linear | Protein derived | Cationic | C24 chain composed of two 12-aminododecanoic acid (ADA) added at N terminal | NA | NA | Nanoparticle (PLGA-NPs) | 25003794 |
2208 | RRRRRRRRR | R9 | 9 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticle (PMS labelled with the fluorescent probe di-4-ANEPPDHQ) | 24583633 |
2209 | RWRRWWRRW | RW9 | 9 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | Nanoparticle (PMS labelled with the fluorescent probe di-4-ANEPPDHQ) | 24583633 |
2210 | RRWRRWWRRWWRRWRR | RW16 | 16 | L | Linear | Synthetic | Amphipathic | Free | Free | NA | Nanoparticle (PMS labelled with the fluorescent probe di-4-ANEPPDHQ) | 24583633 |
2233 | CRQIKIWFQNRRMKWKK | Penetratin | 17 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | NA | Peptide (KLA) and Nanoparticle (DSPC and DSPG liposomes) | 24796502 |
2234 | CRQIKIWFQNRRMKWKKKLAKLAKKLAKLAK | KLA-Pen | 31 | L | Linear | Chimeric | Amphipathic | Acetylation | Amidation | NA | Peptide (KLA) and Nanoparticle (DSPC and DSPG liposomes) | 24796502 |
2292 | RRRRRRRR | F(SG)4R8 | 8 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
2293 | RRRRRRRR | G(SG)4R8 | 8 | L | Linear | Synthetic | Cationic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
2294 | RQIKIWFQNRRMKWKK | F(SG)4Pen | 16 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
2295 | RQIKIWFQNRRMKWKK | G(SG)4Pen | 16 | L | Linear | Protein derived | Cationic and amphipathic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
2296 | AGYLLGKINLKALAALAKKIL | F(SG)4TP10 | 21 | L | Linear | Protein derived | Amphipathic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
2297 | AGYLLGKINLKALAALAKKIL | G(SG)4TP10 | 21 | L | Linear | Protein derived | Amphipathic | Acetylation | Amidation | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
2298 | RGDfK | cRGD | 5 | L | Cyclic | Protein derived | NA | Cycliclization | Cyclization | NA | Fluorophore (Alexa488), Protein (bovine serum albumin) and Nanoparticle (quantum dots) | 25108152 |
2441 | YGRKKRRQRRR | PNIPAM-FL-TAT Peptide | 11 | L | Linear | Protein derived | Cationic | Conjugated with PNIPAM-FL molecule | Free | NA | Nanoparticle [poly(N-isopropylacrylamide) (PNIPAM) microgel particles] | 25170605 |
2469 | WEARLARALARALARHLARALARALRACEA | RALA | 30 | L | Linear | Synthetic | Cationic and amphipathic | Free | Free | NA | Nanoparticle (Cy3-labeled nanoparticles complexed with DNA) | 24995949 |
2470 | VSRRRRRRGGRRRR | C24-LMWP | 14 | L | Linear | Protein derived | Cationic | Free | Free | NA | Nanoparticle (LMWP/PLGA nanoparticles), Small molecule drug (Doxorubicin) | 25003794 |
2487 | IRQRRRR | IRQ | 7 | L | Linear | Synthetic | NA | Free | Conjugation to solid lipid nanoparticle | NA | Protein (FITC-sCT), Nanoparticle( SLN) | 24968819 |
2488 | CSKSSDYQC | CSK | 9 | L | Linear | Synthetic | NA | Free | Conjugation to solid lipid nanoparticle | NA | Protein (FITC-sCT), Nanoparticle( SLN) | 24968819 |
2498 | RRRRRRRR-c(RGDfK) | R8-RGD-lipo | 13 | Modified | Linear | Synthetic | Cationic | Free | Conjugation with cyclic RGD | Cysteine modified octa-arginine conjugated to the branch of lysine | Nanoparticle (CFPE-labeled liposomes), RGD | 24651033 |
2499 | RRRRRRRR | R8-lipo | 8 | L | Linear | Synthetic | Cationic | Free | Conjugation with liposome | NA | Nanoparticle (CFPE-labeled liposomes) | 24651033 |
2502 | CARSKNKDC | CAR | 9 | L | Linear | Synthetic | NA | Free | Conjugation with micelles with green fluorescent 5-carboxyfluorescein | NA | Fluorophore (5-carboxyfluorescein), Nanoparticle (fasudi loaded micelles) | 25266507 |
2504 | YGRKKRRQRRR | TAT-lyophiliosomes | 11 | L | Linear | Protein derived | Cationic | Conjugated with lyophilisome via cysteine linker | Free | NA | Nanoparticle (Lyophiliosomes and FITC labelled) | 25369131 |
2511 | CAYGRKKRRQRRR | PTX-TAT-LP | 13 | L | Linear | Synthetic | Cationic | Conjugated with PTX via cysteine | Conjugation with liposome-GSH | NA | Nanoparticle (PTX with liposome), GSH | 25449709 |
2512 | CAYGRKKRRQRRR | PTX-C-TAT-LP | 13 | L | Linear | Synthetic | Cationic | Conjugated with PTX via cysteine | Conjugation with liposome-GSH | NA | Nanoparticle (PTX with liposome), GSH | 25449709 |
2513 | CYGRKKRRQRRR | PTX-N-TAT-LP | 12 | L | Linear | Synthetic | Cationic | Conjugated with PTX via cysteine | Conjugation with liposome-GSH | NA | Nanoparticle (PTX with liposome), GSH | 25449709 |
2517 | CAYGRKKRRQRRR | TAT-LP-PTX | 13 | L | Linear | Protein derived | Cationic | Cysteine addition | Conjugation with rhodamine LP | NA | Nanoparticle (Liposome) | 25482610 |
2518 | CAYGRKKRRQRRR | T7/TAT-LP-PTX | 13 | L | Linear | Protein derived | Cationic | Conjugated with T7 | Conjugation with rhodamine LP | NA | Nanoparticle (Liposome) | 25482610 |
2519 | CHAIYPRH | T7-LP | 8 | L | Linear | Synthetic | NA | Free | Conjugation with rhodamine LP | NA | Nanoparticle (Liposome) | 25482610 |
2536 | RRRRRRRR | R8-GALA-liposome-IgG | 8 | L | Linear | Synthetic | Cationic | Conjugation with rhodamine via DOPE | Conjugation with GALA-liposome-IgG | NA | Nanoparticle (Liposome), Protein (IgG) | 25546552 |
2537 | RRRRRRRR | R8-GALA-liposome | 8 | L | Linear | Synthetic | Cationic | Conjugation with rhodamine via DOPE | Conjugation with GALA-liposome | NA | Nanoparticle (Liposome) | 25546552 |
2538 | RRRRRRRR | R8-liposome | 8 | L | Linear | Synthetic | Cationic | Conjugation with rhodamine via DOPE | Conjugation with liposome | NA | Nanoparticle (Liposome) | 25546552 |
2541 | YGRKKRRQRRR-C | DSPE-PEG-2K-TAT | 12 | L | Linear | Synthetic | Cationic | Conjugated with DSPE-PEG(2000) to FITC labeled Tat | Free | NA | Nanoparticle (Rhodamine labelled miscelles and Liposomes) | 23186944 |
2548 | RQIKIWFQNRRMKWKKGG | CS-Lin-Pen | 18 | L | Linear | Protein derived | Cationic | Conjugated to CS-Lin | Free | NA | Nanoparticles (FITC labeled CS-Lin) | 24083483 |
2560 | CRQIKIWFQNRRMKWKK | KLA-Pen | 17 | L | Linear | Chimeric | Cationic | Conjugated with KLA | Amidation | NA | Peptide (KLA), Nanoparticle (liposome) | 24796502 |
2574 | RRRRRRRR | R8-lip | 8 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticle (Liposomes) | 24901376 |
2575 | KKKKKKKK | K8-lip | 8 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticle (Liposomes) | 24901376 |
2585 | AYGRKKRRQRRR | DOX-T7-TAT-LIP | 12 | L | Linear | Protein derived | Cationic | Cysteine addition | Free | NA | Nanoparticle (Liposome), Small molecule drug (Doxorubicin), protein (Transferin) | 24893333 |
2590 | AYGRKKRRQRRR | TAT-cysteine peptide | 12 | L | Linear | Protein derived | Cationic | Free | Free | NA | Nanoparticle (Liposomes) | 24709209 |
2594 | RRRRRRRR-RGD | R8-RGD | 11 | L | Linear | Synthetic | Cationic | Free | Free | NA | Nanoparticle (Liposome) | 24651033 |
2597 | CCTGRKKRRQRRR | TAT | 13 | L | Linear | Protein derived | Cationic | Free | Free | NA | Nanoparticle | 24736021 |