Browse result page of CancerPDF Database
Please click on CancerPDF_ID for detailed information about peptide.
| CancerPDF_ID | Peptide seq | Protein Name | Fluid | Mass/Z | Profiling Technique | Cancer Type | Expression Regulation | PUBMED ID |
|---|---|---|---|---|---|---|---|---|
| CancerPDF_ID1019 | LAEGGGVR | Fibrinopeptide A | Serum | 758.45 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.66, 0.95 and 0.65 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1020 | FLAEGGGVR | Fibrinopeptide A | Serum | 905.5 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "For bladder (Lower) and for breast (Higher) Differential ion intensity in cancer compare to normal with Ratio of median intensity (patients/Controls) = 0.97, 0.73 and 1.48 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1021 | DFLAEGGGVR | Fibrinopeptide A | Serum | 1020.47 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.28, 0.28 and 0.47 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1022 | GDFLAEGGGVR | Fibrinopeptide A | Serum | 1077.53 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.54, 0.5 and 0.97 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1023 | EGDFLAEGGGVR | Fibrinopeptide A | Serum | 1206.57 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.5, 0.44 and 0.69 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1024 | GEGDFLAEGGGVR | Fibrinopeptide A | Serum | 1263.6 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.2, 0.24 and 0.23 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1025 | SGEGDFLAEGGGVR | Fibrinopeptide A | Serum | 1350.64 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.47, 0.46 and 0.35 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1026 | DSGEGDFLAEGGGVR | Fibrinopeptide A | Serum | 1465.65 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.66, 0.55 and 0.8 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1027 | ADSGEGDFLAEGGGVR | Fibrinopeptide A | Serum | 1536.68 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.58, 0 and 0.54 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1028 | GSESGIFTNTKESSSHHPGIAEFPSRG | Fibrinogen alpha chain | Serum | 2816.25 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 68, 223 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1029 | SSSYSKQFTSSTSYNRGDSTFES | Fibrinogen alpha chain | Serum | 2553.01 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 1.35, 1.31 and 1.5 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1030 | SSSYSKQFTSSTSYNRGDSTFESKS | Fibrinogen alpha chain | Serum | 2768.3 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.77, 0.03 and 0.98 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1031 | SSSYSKQFTSSTSYNRGDSTFESKSY | Fibrinogen alpha chain | Serum | 2931.29 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in bladder cancer and upregulated in prostate cancer vs normal with Ratio of median intensity (patients/Controls) = 1.24, 0.13 and 0.97 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1032 | SSSYSKQFTSSTSYNRGDSTFESKSYKM | Fibrinogen alpha chain | Serum | 3190.4 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.52, 0 and 0.94 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1033 | SSSYSKQFTSSTSYNRGDSTFESKSYKMA | Fibrinogen alpha chain | Serum | 3261.4 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 0.33, 0.08 and 0.74 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1034 | SSYSKQFTSSTSYNRGDSTFE | Fibrinogen alpha chain | Serum | 2379.03 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "For bladder (Lower) and for breast (Higher) Differential ion intensity in cancer compare to normal with Ratio of median intensity (patients/Controls) = 1.57, 0.22 and 1.71 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1035 | NA | Fibrinogen alpha chain | Serum | 3206.34 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1036 | NA | Fibrinogen alpha chain | Serum | 3277.39 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1037 | DEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 2659.03 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 1.37, 1.18 and 2.45 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1038 | SYKMADEAGSEADHEGTHSTKRGHAKSRPV | Fibrinogen alpha chain | Serum | 3239.22 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1039 | HWESASLL | Complement C3f | Serum | 942.44 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "For Breast (Lower) and for Bladder (Higher) Differential ion intensity in cancer compare to normal with Ratio of median intensity (patients/Controls) = 1.74, 5.18 and 0.58 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1040 | IHWESASLL | Complement C3f | Serum | 1055.6 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) = 227, 1051 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1041 | RIHWESASLL | Complement C3f | Serum | 1211.7 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =7.86, 10.8 and 0.01 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1042 | HRIHWESASLL | Complement C3f | Serum | 1348.7 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1043 | THRIHWESASLL | Complement C3f | Serum | 1449.76 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "For Prostate & bladder (Higher) Differential ion intensity in cancer compare to normal with Ratio of median intensity (patients/Controls) =1885, 2646 and 437 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1044 | ITHRIHWESASLL | Complement C3f | Serum | 1562.84 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =0.79, 1.13 and 0.54 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1045 | KITHRIHWESASLL | Complement C3f | Serum | 1690.9 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "For Prostate & bladder (Higher) Differential ion intensity in cancer compare to normal with Ratio of median intensity (patients/Controls) =4.05, 6.85 and 1.01 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1046 | SKITHRIHWESASLL | Complement C3f | Serum | 1777.94 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "For Prostate & bladder (Higher) Differential ion intensity in cancer compare to normal with Ratio of median intensity (patients/Controls) =4.37, 7.7 and 0.96 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1047 | SSKITHRIHWESASLL | Complement C3f | Serum | 1864.95 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "For Prostate & bladder (Higher) and for breast (Lower) Differential ion intensity in cancer compare to normal with Ratio of median intensity (patients/Controls) =2.18, 3.33 and 0.3 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1048 | SSKITHRIHWESASLLR | Complement C3f | Serum | 2021.06 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1049 | SSKITHRIHWESASL | Complement C3f | Serum | 1751.88 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.82, 5.7 and 1.36 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1050 | NGFKSHALQLNNR | Complement C4 precursor | Serum | 1498.91 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 809 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1051 | NGFKSHALQLNNRQ | Complement C4 precursor | Serum | 1626.85 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.09, 0.88 and 2.78 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1052 | NGFKSHALQLNNRQI | Complement C4 precursor | Serum | 1739.93 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =0.75, 0.66 and 2.75 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1053 | NGFKSHALQLNNRQIR | Complement C4 precursor | Serum | 1895.99 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.27, 3.33 and 2.95 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1054 | GLEEELQFSLGSKINV | Complement C4 precursor | Serum | 1762.87 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "For bladder (Lower) and for breast (Higher) Differential ion intensity in cancer compare to normal with Ratio of median intensity (patients/Controls) =1.62, 0.01 and 3.16 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1055 | GLEEELQFSLGSKINVKVGGNS | Complement C4 precursor | Serum | 2305.2 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =3.75, 2.56 and 3.49 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1056 | GLEEELQFSLGSKINVKVGGNSKGTL | Complement C4 precursor | Serum | 2704.13 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =61, 49 and 133 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1057 | GLEEELQFSLGSKINVKVGGNSKGTLKVLR | Complement C4 precursor | Serum | 3200.52 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1058 | TLEIPGNSDPNMIPDGDFNSYVR | Complement C4 precursor | Serum | 2551.06 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1059 | HAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H4 | Serum | 842.4 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in Prostate cancer vs normal,Downregulated in Bladder cancer vs normal with Ratio of median intensity (patients/Controls) =1.49, 0.01 and 1.04 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1060 | GLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H5 | Serum | 1786.86 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =2.39, 2.88 and 2.3 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1061 | QLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H6 | Serum | 2028.01 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1062 | SRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H7 | Serum | 2271.14 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =4.58, 2.64 and 1.46 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1063 | SSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H8 | Serum | 2358.09 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =100, 73 and 531 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1064 | GVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H9 | Serum | 2627.48 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Downregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =2.24, 0.26 and 1.07 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1065 | PGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H10 | Serum | 2724.48 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.75, 6.17 and 1.64 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1066 | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H11 | Serum | 3272.5 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 1277 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1067 | QAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF | Inter-alpha-trypsin inhibitor heavy chain H12 | Serum | 3970.97 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 957 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1068 | QLGLPGPPDVPDHAAYHPFR | Inter-alpha-trypsin inhibitor heavy chain H13 | Serum | 2183.91 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.71, 1.79 and 2.83 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1069 | HAAYHPFR | Inter-alpha-trypsin inhibitor heavy chain H14 | Serum | 998.45 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =121, 256 and 147 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1070 | NVHSGSTFFKYYLQGAKIPKPEASFSPR | Inter-alpha-trypsin inhibitor heavy chain H15 | Serum | 3156.52 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =3.43, 10.68 and 1.33 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1071 | NVHSAGAAGSRMNFRPGVLSS | PRO1851(ITIH4 splice variant) | Serum | 2115.01 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =3.22, 12.23 and 10.61 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1072 | ATEHLSTLSEKAKPALEDL | Apolipoprotein A-I | Serum | 2052.89 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =105, 306 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1073 | QGLLPVLESFKVSFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 3182.46 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =0.74, 6.36 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1074 | VSFLSALEEYTKKLNTQ | Apolipoprotein A-I | Serum | 1971.16 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 641 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1075 | ELQEGARQKLHELQE | Apolipoprotein A-I | Serum | 1807.78 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1076 | AELQEGARQKLHELQEKLSPLGEEMRDRA | Apolipoprotein A-I | Serum | 3377.45 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1077 | ISASAEELRQRLAPLAEDVRGNL | Apolipoprotein A-IV | Serum | 2508.16 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.38, 1.2 and 7.96 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1078 | SLAELGGHLDQQVEEF | Apolipoprotein A-IV | Serum | 1771.81 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =148, 220 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1079 | GNTEGLQKSLAELGGHLDQQVEEF | Apolipoprotein A-IV | Serum | 2599.18 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1080 | GNTEGLQKSLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 2755.2 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.11, 12.37 and 1.22 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1081 | SLAELGGHLDQQVEEFR | Apolipoprotein A-IV | Serum | 1927.94 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =79, 671 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1082 | DVSSALDKLKEFGNTLEDKARELIS | Apolipoprotein C-I | Serum | 2778.15 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1083 | TVGSLAGQPLQERAQAWGERL | Apolipoprotein E | Serum | 2267.07 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1084 | AATVGSLAGQPLQERAQAWGERL | Apolipoprotein E | Serum | 2409.13 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =97, 2124 and 109 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1085 | AATVGSLAGQPLQERAQAWGERLR | Apolipoprotein E | Serum | 2565.45 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 902 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1086 | HFFFPK | Clusterin precursor | Serum | 822.41 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.15, 4.66 and 0.76 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1087 | HFFFPKSRIV | Clusterin precursor | Serum | 1277.71 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =251, 1406 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1088 | RPPGFSPF | Bradykinin (and des-Arg bradykinin) | Serum | 904.48 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "For bladder (Lower) and for breast (Higher) Differential ion intensity in cancer compare to normal with Ratio of median intensity (patients/Controls) =1.06, 0.79 and 1.62 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1089 | RPPGFSPFR | Bradykinin (and des-Arg bradykinin) | Serum | 1060.57 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "For bladder (Lower) and for breast (Higher) Differential ion intensity in cancer compare to normal with Ratio of median intensity (patients/Controls) =0.77, 0.43 and 1.9 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1090 | NA | Bradykinin (and des-Arg bradykinin) | Serum | 920.41 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1091 | NA | Bradykinin (and des-Arg bradykinin) | Serum | 1076.53 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1092 | NLGHGHKHERDQGHGHQ | HMW Kininogen | Serum | 1943.88 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.58, 141 and 1 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1093 | KHNLGHGHKHERDQGHGHQ | HMW Kininogen | Serum | 2209.08 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1.72, 2.07 and 1.56 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1094 | GHGLGHGHEQQHGLGHGHKF | HMW Kininogen | Serum | 2126.94 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID1095 | AVPPNNSNAAEDDLPTVELQGVVPR | Factor XIIIa | Serum | 2602.15 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =2.84, 2.3 and 4.73 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1096 | ALGISPFHEHAEVVFTANDSGPR | Transtherin precursor (‘prealbumin’) | Serum | 2451.11 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =0.02, 1.17 and 3.07 in prostate, bladder and breast cancer respectively" | 16395409 |
| CancerPDF_ID1097 | PDAPRIKKIVQKKLAGDESAD | Platelet basic protein Precursor | Serum | 2279.18 | MALDI-TOF | "Advanced Prostate, Breast and Bladder cancer" | NA | 16395409 |
| CancerPDF_ID3416 | YTKVVHYRKWIKDTIVANP | Puromycin-sensitive aminopeptidase | Urine | 2332.3 | MALDI digital ion trap (DIT) TOF | Prostate cancer | Differentially expressed between normal and patients | 25233230 |