| Primary information |
|---|
| CancerPDF_ID | CancerPDF_ID1038 |
| PMID | 16395409 |
| Peptide Sequence | SYKMADEAGSEADHEGTHSTKRGHAKSRPV |
| Peptide Sequence in Publication | SYKMADEAGSEADHEGTHSTKRGHAKSRPV (R) |
| Protein Name | Fibrinogen alpha chain |
| UniprotKB Entry Name | FIBA_HUMAN |
| Biofluid | Serum |
| M/Z | 3239.22 |
| Charge | 1 |
| Mass/H+ | NA |
| Mass (in Daltons) | NA |
| Profiling Technique | MALDI-TOF |
| Peptide Identification Technique | Q/TOF/TOF and LC-MS/MS |
| Quantification Technique | NA |
| Labeling | Label Free |
| FDR | less than 1 Ã 10–5 |
| p-Value | 0.575 |
| Software | MASCOT (v 2.0.04 for Windows) |
| Length of Peptide | 30 |
| Cancer Type | "Advanced Prostate, Breast and Bladder cancer" |
| Database for Peptide search | NCBI refseq Protein Database |
| Modification | NA |
| Number of Patients | "Advanced prostate (n = 32), breast (n = 21), and bladder (n = 20) cancer, 33 healthy" |
| Regulation/Differential Expression | NA |
| Validation | Independent validation |
| Sensitivity | 97.5% on independent validation dataset |
| Specificity | NA |
| Accuracy | 97.5 % on validation dataset |
| Secondary information |
|---|
| Peptide Atlas | NA |
| IEDB | |