| Primary information |
|---|
| sequence ID | Seq_6118 |
| Peptide sequence | QAGAAGSRMNFRPGVLSSRQLGLPGPPDVPDHAAYHPF |
| CancerPDF_ID | CancerPDF_ID56, CancerPDF_ID1067, CancerPDF_ID12741, |
| PMID | 16896061,16395409,27058005 |
| Protein Name | Inter-alpha-trypsin inhibitor heavy chain H14,Inter-alpha-trypsin inhibitor heavy chain H12,Inter-alpha-trypsin inhibitor heavy chain H5 |
| UniprotKB Entry Name | ITIH4_HUMAN,ITIH4_HUMAN,ITIH5_HUMAN |
| Fluid | Serum,Serum,Serum |
| M/Z | 3970.97,3970.97,3969.989 |
| Charge | 1,1,NA |
| Mass (in Da) | 3970.97,NA,NA |
| fdr | NA,NA,NA |
| Profiling Technique | MALDI-TOF,MALDI-TOF,MALDI-TOF |
| Peptide Identification technique | Q/TOF MS/MS,Q/TOF/TOF and LC-MS/MS,LC-MS/MS |
| Quantification Technique | NA,NA,NA |
| Labelled/Label Free | Label Free,Label Free,Label Free |
| FDR | NA,less than 1 “5,NA |
| CancerPDF_ID | CancerPDF_ID56, CancerPDF_ID1067, CancerPDF_ID12741, |
| p-Value | 1.00E-05,2.68E-09,"less than 0.01,0.242,0.205" |
| Software | MASCOT,MASCOT (v 2.0.04 for Windows),Proteome Discoverer |
| Length | 38,38,38 |
| Cancer Type | Metastatic thyroid carcinomas,"Advanced Prostate, Breast and Bladder cancer",Breast cancer |
| Database | NCBI refseq Protein Database,NCBI refseq Protein Database,SwissProt Database |
| Modification | NA,NA,Gln->pyro-Glu (N-term Q); Oxidation (M) |
| Number of Patients | 40 metastatic thyroid carcinoma patients and 40 normal for training phase and 10 metastatic thyroid carcinoma and 10 normal individuals for independent validation,"Advanced prostate (n = 32), breast (n = 21), and bladder (n = 20) cancer, 33 healthy in training test set, In validation set 41 independent serum samples from patients with advanced prostate cancer (prostate 2 [PR2])"," 28 were diagnosed with Breast cancer, 27 remained cancer-free with BRCA carrier. Of the remaining patients, 39 were diagnosed with sporadic breast cancer (SBC), and 38 were healthy volunteers (WT)." |
| Regulation | NA,"Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 957 and 1 in prostate, bladder and breast cancer respectively","Upregulated with the fold change of 0.57 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.82, Upregulated in BC vs healthy with 1.170 fold change" |
| Validation | Independent validation,Independent validation,NA |
| Sensitivity | 95% on independent dataset,97.5% on independent validation dataset,NA |
| Specificity | 95% on independent dataset,NA,NA |
| Accuracy | NA,97.5 % on validation dataset,NA |
| Peptide Atlas | NA |
| IEDB | |