Primary information |
---|
CancerPDF_ID | CancerPDF_ID1066 |
PMID | 16395409 |
Peptide Sequence | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF |
Peptide Sequence in Publication | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF |
Protein Name | Inter-alpha-trypsin inhibitor heavy chain H11 |
UniprotKB Entry Name | ITIH4_HUMAN |
Biofluid | Serum |
M/Z | 3272.5 |
Charge | 1 |
Mass/H+ | NA |
Mass (in Daltons) | NA |
Profiling Technique | MALDI-TOF |
Peptide Identification Technique | Q/TOF/TOF and LC-MS/MS |
Quantification Technique | NA |
Labeling | Label Free |
FDR | less than 1 Ã 10–5 |
p-Value | 2.82E-14 |
Software | MASCOT (v 2.0.04 for Windows) |
Length of Peptide | 30 |
Cancer Type | "Advanced Prostate, Breast and Bladder cancer" |
Database for Peptide search | NCBI refseq Protein Database |
Modification | NA |
Number of Patients | "Advanced prostate (n = 32), breast (n = 21), and bladder (n = 20) cancer, 33 healthy in training test set, In validation set 41 independent serum samples from patients with advanced prostate cancer (prostate 2 [PR2])" |
Regulation/Differential Expression | "Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 1277 and 1 in prostate, bladder and breast cancer respectively" |
Validation | Independent validation |
Sensitivity | 97.5% on independent validation dataset |
Specificity | NA |
Accuracy | 97.5 % on validation dataset |
Secondary information |
---|
Peptide Atlas | NA |
IEDB | |