| Primary information |
|---|
| sequence ID | Seq_5425 |
| Peptide sequence | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF |
| CancerPDF_ID | CancerPDF_ID55, CancerPDF_ID1066, CancerPDF_ID3037, CancerPDF_ID3038, CancerPDF_ID8564, CancerPDF_ID8614, CancerPDF_ID9945, CancerPDF_ID9953, CancerPDF_ID11055, CancerPDF_ID12739, CancerPDF_ID12740, |
| PMID | 16896061,16395409,21136997,21136997,23667664,26705257,21124649,21137033,26993605,27058005,27058005 |
| Protein Name | Inter-alpha-trypsin inhibitor heavy chain H13,Inter-alpha-trypsin inhibitor heavy chain H11,Inter-alpha-trypsin inhibitor heavy chain H4,Inter-alpha-trypsin inhibitor heavy chain H4,Inter-alpha-trypsin inhibitor heavy chain H4,Inter- trypsin inhibitor heavy chain H4 (ITIH4) fragment,Inter-alpha-trypsin inhibitor heavy chain H4,Inter-alpha-trypsin inhibitor heavy chain H4,ITIH4,Inter-alpha-trypsin inhibitor heavy chain H5,Inter-alpha-trypsin inhibitor heavy chain H5 |
| UniprotKB Entry Name | ITIH4_HUMAN,ITIH4_HUMAN,ITIH4_HUMAN,ITIH4_HUMAN,ITIH4_HUMAN,ITIH4_HUMAN,ITIH4_HUMAN,ITIH4_HUMAN,ITIH4_HUMAN,ITIH5_HUMAN,ITIH5_HUMAN |
| Fluid | Serum,Serum,Plasma,Plasma,Serum,Serum,Serum,Serum,Serum,Serum,Serum |
| M/Z | 3272.5,3272.5,3271.6349,3287.6298,3271.63,3273.69,NA,NA,3273,3272.752,3288.759 |
| Charge | 1,1,1,1,1,NA,NA,NA,NA,NA,NA |
| Mass (in Da) | 3272.63,NA,NA,NA,3274.73,NA,NA,NA,NA,NA,NA |
| fdr | NA,NA,NA,NA,NA,NA,NA,NA,NA,NA,NA |
| Profiling Technique | MALDI-TOF,MALDI-TOF,LC-MS,LC-MS,MALDI-TOF,MALDI-TOF,LC-MS,LC-MS,MALDI-TOF,MALDI-TOF,MALDI-TOF |
| Peptide Identification technique | Q/TOF MS/MS,Q/TOF/TOF and LC-MS/MS,LC-MS-MS/MS,LC-MS-MS/MS,FT-ICR MS/MS + nano-HPLC,LC-ESI-MS/MS,LC-ESI-MS/MS,LC-MS/MS,LTQ-Orbitrap-MS/MS,LC-MS/MS,LC-MS/MS |
| Quantification Technique | NA,NA,LC-ESI-MS,LC-ESI-MS,NA,NA,NA,NA,NA,NA,NA |
| Labelled/Label Free | Label Free,Label Free,Label Free,Label Free,Label Free,Label Free,Labelled,Labelled,Label Free,Label Free,Label Free |
| FDR | NA,less than 1 “5,NA,NA,NA,NA,NA,NA,less than 0.000005,NA,NA |
| CancerPDF_ID | CancerPDF_ID55, CancerPDF_ID1066, CancerPDF_ID3037, CancerPDF_ID3038, CancerPDF_ID8564, CancerPDF_ID8614, CancerPDF_ID9945, CancerPDF_ID9953, CancerPDF_ID11055, CancerPDF_ID12739, CancerPDF_ID12740, |
| p-Value | 1.00E-05,2.82E-14,NA,NA,NA,1.00E-06,less than 0.05,less than 0.05,less than 0.05,"less than 0.01,0.470,0.760","less than 0.01,0.446,0.360" |
| Software | MASCOT,MASCOT (v 2.0.04 for Windows),MASCOT(v. 2.2.01),MASCOT(v. 2.2.01),MASCOT,ClinProTools,NA,NA,SEQUEST,Proteome Discoverer,Proteome Discoverer |
| Length | 30,30,30,30,30,30,30,30,30,30,30 |
| Cancer Type | Metastatic thyroid carcinomas,"Advanced Prostate, Breast and Bladder cancer",Normal,Normal,"Breast cancer, Lung cancer, Rectal cancer",Breast cancer,Breast cancer,Breast cancer,Esophageal squamous cell carcinoma (ESCC),Breast cancer,Breast cancer |
| Database | NCBI refseq Protein Database,NCBI refseq Protein Database,SwissProt Database,SwissProt Database,NA,Uniprot protein sequence Database,NCBI Protein Database,NA,IPI Human Database (3.45),SwissProt Database,SwissProt Database |
| Modification | NA,NA,NA,Oxidation at Met,NA,NA,ITIH4-30,ITIH4-30,NA,NA,Gln->pyro-Glu (N-term Q); Oxidation (M) |
| Number of Patients | 40 metastatic thyroid carcinoma patients and 40 normal for training phase and 10 metastatic thyroid carcinoma and 10 normal individuals for independent validation,"Advanced prostate (n = 32), breast (n = 21), and bladder (n = 20) cancer, 33 healthy in training test set, In validation set 41 independent serum samples from patients with advanced prostate cancer (prostate 2 [PR2])",27 healthy individuals,27 healthy individuals,"Breast Cancer =84, lung cancer= 70, Rectal cancer = 30patients; 500 healthy",96 Breast Cancer patients and 64 healthy controls,9 BC and 9 control,45 BC and 78 control,for training 100 ESCC patients and 98 healthy individuals were used and for validation 101 ESCC patients and 98 healthy individuals were used," 28 were diagnosed with Breast cancer, 27 remained cancer-free with BRCA carrier. Of the remaining patients, 39 were diagnosed with sporadic breast cancer (SBC), and 38 were healthy volunteers (WT)."," 28 were diagnosed with Breast cancer, 27 remained canc |
| Regulation | NA,"Upregulated in cancer vs normal with Ratio of median intensity (patients/Controls) =1, 1277 and 1 in prostate, bladder and breast cancer respectively",NA,NA,NA,Upregulated in cancer as compare to normal control with fold change of 1.7,Differentially expressed between cancer vs control,Differentially expressed between cancer vs control,Downregulated in ESCC patients vs control with mean intensity in cancer 221.86 and mean intensity in normal 764.46,"Upregulated with the fold change of 0.42 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.89, Upregulated in BC vs healthy with 1.036 fold change","Upregulated with the fold change of 0.34 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.85, Upregulated in BC vs healthy with 1.126 fold change" |
| Validation | Independent validation,Independent validation,Leave One out Cross validation,Leave One out Cross validation,NA,NA,NA,NA,external cross validation done,NA,NA |
| Sensitivity | 95% on independent dataset,97.5% on independent validation dataset,NA,NA,NA,NA,NA,NA,97% on training dataset and 97.3 on validation dataset,NA,NA |
| Specificity | 95% on independent dataset,NA,NA,NA,NA,NA,NA,NA,95.92% on training dataset and 100% on validation dataset,NA,NA |
| Accuracy | NA,97.5 % on validation dataset,NA,NA,NA,NA,NA,NA,NA,NA,NA |
| Peptide Atlas | NA |
| IEDB | |