Primary information |
---|
CancerPDF_ID | CancerPDF_ID12740 |
PMID | 27058005 |
Peptide Sequence | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF |
Peptide Sequence in Publication | MNFRPGVLSSRQLGLPGPPDVPDHAAYHPF |
Protein Name | Inter-alpha-trypsin inhibitor heavy chain H5 |
UniprotKB Entry Name | ITIH5_HUMAN |
Biofluid | Serum |
M/Z | 3288.759 |
Charge | NA |
Mass/H+ | NA |
Mass (in Daltons) | NA |
Profiling Technique | MALDI-TOF |
Peptide Identification Technique | LC-MS/MS |
Quantification Technique | NA |
Labeling | Label Free |
FDR | NA |
p-Value | "less than 0.01,0.446,0.360" |
Software | Proteome Discoverer |
Length of Peptide | 30 |
Cancer Type | Breast cancer |
Database for Peptide search | SwissProt Database |
Modification | Gln->pyro-Glu (N-term Q); Oxidation (M) |
Number of Patients | " 28 were diagnosed with Breast cancer, 27 remained cancer-free with BRCA carrier. Of the remaining patients, 39 were diagnosed with sporadic breast cancer (SBC), and 38 were healthy volunteers (WT)." |
Regulation/Differential Expression | "Upregulated with the fold change of 0.34 in breast cancer vs Cancer free patients with brca mutation, Upregulated in breast cancer vs sporadic breast cancer with fold change of 0.85, Upregulated in BC vs healthy with 1.126 fold change" |
Validation | NA |
Sensitivity | NA |
Specificity | NA |
Accuracy | NA |
Secondary information |
---|
Peptide Atlas | NA |
IEDB | |