PRRID_1382 | internalized flagellin Click for more detail | Salmonella typhimurium or Legionella pneumophila (Bacteria) | KLSFEDKNGKVIDGGYAVKMGDDFYAATYDEKTGAITAKTTTYTDGTGVAQTGAVKFGGANGKSEVVTATDGKTYL | 76 | Protein | Natural | Flagellin and LPS stimulate the production of CXCL1 and CXCL2 | Nod-like receptor C4 (NLRC4) | NOD-like receptor (NLR) | Human | medullary collecting duct (MCD) cells | intracellular receptors | Q9NPP4.fasta | Q9NPP4 | 1024 | assemble in an inflammasome complex to activate caspase-1 and promote the release of IL-1β and IL-18 | ELISA, adhesion and invasion assay | 24779433 | 2014 | Pubchem_assay | |