| Primary information |
|---|
| PRRID | PRRID_1341 |
| Ligand Name | HMGB1 |
| Source | Endogenous (others) |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | HMGB1 is a key regulator of nucleosome formation and gene transcription that acts as a cytokine following cell injury. |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells |
| Domain | cell surface |
| Sequence of Receptor | Q9QUN7.fasta |
| Swiss prot ID | Q9QUN7 |
| Length Of Receptor | 784 |
| Function | Possible effect in case of stroke i.e Up-regulation of TLR2 mRNA correlates with severity of ischemia |
| Assay used | NA |
| PMID | 24807166 |
| Year of Publication | 2014 |
| Pubchem assay | Pubchem_assay |
| Primary information |
|---|
| PRRID | PRRID_1341 |
| Ligand Name | HMGB1 |
| Source | Endogenous (others) |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | HMGB1 is a key regulator of nucleosome formation and gene transcription that acts as a cytokine following cell injury. |
| Name of receptor | Toll-like receptor 2 (TLR2) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells |
| Domain | cell surface |
| Sequence of Receptor | Q9QUN7.fasta |
| Swiss prot ID | Q9QUN7 |
| Length Of Receptor | 784 |
| Function | Possible effect in case of stroke i.e Up-regulation of TLR2 mRNA correlates with severity of ischemia |
| Assay used | NA |
| PMID | 24807166 |
| Year of Publication | 2014 |
| Pubchem assay | Pubchem_assay |