| Primary information |
|---|
| PRRID | PRRID_1331 |
| Ligand Name | HMGB1 |
| Source | Human (others) |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | play an important role in infectious inflammatory responses. |
| Name of receptor | Toll-like receptor 9 (TLR9) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | monocyte/macrophages, plasmacytoid DCs and B-lymphocytes |
| Domain | Cell Compartment/Intracellular (Endosome) |
| Sequence of Receptor | Q9NR96.fasta |
| Swiss prot ID | Q9NR96 |
| Length Of Receptor | 1032 |
| Function | induces pro-inflammatory cytokine response |
| Assay used | NA |
| PMID | 24830024 |
| Year of Publication | 2014 |
| Pubchem assay | Pubchem_assay |
| Primary information |
|---|
| PRRID | PRRID_1331 |
| Ligand Name | HMGB1 |
| Source | Human (others) |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | play an important role in infectious inflammatory responses. |
| Name of receptor | Toll-like receptor 9 (TLR9) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | monocyte/macrophages, plasmacytoid DCs and B-lymphocytes |
| Domain | Cell Compartment/Intracellular (Endosome) |
| Sequence of Receptor | Q9NR96.fasta |
| Swiss prot ID | Q9NR96 |
| Length Of Receptor | 1032 |
| Function | induces pro-inflammatory cytokine response |
| Assay used | NA |
| PMID | 24830024 |
| Year of Publication | 2014 |
| Pubchem assay | Pubchem_assay |