Primary information |
---|
PRRID | PRRID_1344 |
Ligand Name | HMGB1 |
Source | NA |
Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
Length | 215 |
Type | Protein |
Occurence | Natural |
Role of Ligand | HMGB1 is a key regulator of nucleosome formation and gene transcription that acts as a cytokine following cell injury. |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Human |
Localization | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte |
Domain | cell surface |
Sequence of Receptor | O00206.fasta |
Swiss prot ID | O00206 |
Length Of Receptor | 839 |
Function | Possible effect in case of stroke i.e it is Involved in preconditioning, Up-regulation of TLR4 mRNA correlates with the severity of ischemia, TLR4-deficient animals have better outcome following cerebral ischemia |
Assay used | NA |
PMID | 24807166 |
Year of Publication | 2014 |
Pubchem assay | Pubchem_assay |
Primary information |
---|
PRRID | PRRID_1344 |
Ligand Name | HMGB1 |
Source | NA |
Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
Length | 215 |
Type | Protein |
Occurence | Natural |
Role of Ligand | HMGB1 is a key regulator of nucleosome formation and gene transcription that acts as a cytokine following cell injury. |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Human |
Localization | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte |
Domain | cell surface |
Sequence of Receptor | O00206.fasta |
Swiss prot ID | O00206 |
Length Of Receptor | 839 |
Function | Possible effect in case of stroke i.e it is Involved in preconditioning, Up-regulation of TLR4 mRNA correlates with the severity of ischemia, TLR4-deficient animals have better outcome following cerebral ischemia |
Assay used | NA |
PMID | 24807166 |
Year of Publication | 2014 |
Pubchem assay | Pubchem_assay |