| Primary information |
|---|
| PRRID | PRRID_1343 |
| Ligand Name | HMGB1 |
| Source | NA |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | HMGB1 is a key regulator of nucleosome formation and gene transcription that acts as a cytokine following cell injury. |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte |
| Domain | cell surface |
| Sequence of Receptor | Q9QUK6.fasta |
| Swiss prot ID | Q9QUK6 |
| Length Of Receptor | 835 |
| Function | Possible effect in case of stroke i.e it is Involved in preconditioning, Up-regulation of TLR4 mRNA correlates with the severity of ischemia, TLR4-deficient animals have better outcome following cerebral ischemia |
| Assay used | NA |
| PMID | 24807166 |
| Year of Publication | 2014 |
| Pubchem assay | Pubchem_assay |
| Primary information |
|---|
| PRRID | PRRID_1343 |
| Ligand Name | HMGB1 |
| Source | NA |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | HMGB1 is a key regulator of nucleosome formation and gene transcription that acts as a cytokine following cell injury. |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte |
| Domain | cell surface |
| Sequence of Receptor | Q9QUK6.fasta |
| Swiss prot ID | Q9QUK6 |
| Length Of Receptor | 835 |
| Function | Possible effect in case of stroke i.e it is Involved in preconditioning, Up-regulation of TLR4 mRNA correlates with the severity of ischemia, TLR4-deficient animals have better outcome following cerebral ischemia |
| Assay used | NA |
| PMID | 24807166 |
| Year of Publication | 2014 |
| Pubchem assay | Pubchem_assay |