| Primary information |
|---|
| PRRID | PRRID_1329 |
| Ligand Name | HMGB1 |
| Source | Human (others) |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | play an important role in infectious inflammatory responses. |
| Name of receptor | Toll-like receptor 2 (TLR2)/Toll-like receptor 6 (TLR6) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells |
| Domain | Cell Surface (Exogenous) |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | significant role in the pathogenesis of severe inflammatory responses |
| Assay used | NA |
| PMID | 24830024 |
| Year of Publication | 2014 |
| Pubchem assay | NA |
| Primary information |
|---|
| PRRID | PRRID_1329 |
| Ligand Name | HMGB1 |
| Source | Human (others) |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | play an important role in infectious inflammatory responses. |
| Name of receptor | Toll-like receptor 2 (TLR2)/Toll-like receptor 6 (TLR6) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells |
| Domain | Cell Surface (Exogenous) |
| Sequence of Receptor | NA |
| Swiss prot ID | NA |
| Length Of Receptor | NA |
| Function | significant role in the pathogenesis of severe inflammatory responses |
| Assay used | NA |
| PMID | 24830024 |
| Year of Publication | 2014 |
| Pubchem assay | NA |