| Primary information |
|---|
| PRRID | PRRID_1334 |
| Ligand Name | HMGB1 |
| Source | NA |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | play a critical role in the pathogenesis of inflammation |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Endotoxemic Mice |
| Localization | monocyte/macrophages |
| Domain | cell surface |
| Sequence of Receptor | Q9QUK6.fasta |
| Swiss prot ID | Q9QUK6 |
| Length Of Receptor | 835 |
| Function | HMGB1-TLR4 signaling can activate macrophages and up-regulate the expression of cytokines |
| Assay used | qRT-PCR, immunofluorescence assay, western blot |
| PMID | 24802390 |
| Year of Publication | 2014 |
| Pubchem assay | Pubchem_assay |
| Primary information |
|---|
| PRRID | PRRID_1334 |
| Ligand Name | HMGB1 |
| Source | NA |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | play a critical role in the pathogenesis of inflammation |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Endotoxemic Mice |
| Localization | monocyte/macrophages |
| Domain | cell surface |
| Sequence of Receptor | Q9QUK6.fasta |
| Swiss prot ID | Q9QUK6 |
| Length Of Receptor | 835 |
| Function | HMGB1-TLR4 signaling can activate macrophages and up-regulate the expression of cytokines |
| Assay used | qRT-PCR, immunofluorescence assay, western blot |
| PMID | 24802390 |
| Year of Publication | 2014 |
| Pubchem assay | Pubchem_assay |