| Primary information |
|---|
| PRRID | PRRID_1592 |
| Ligand Name | profilin-like protein |
| Source | T. gondii (others) |
| Sequence of ligand | MSDWDPVVKEWLVDTGYCCAGGIANVSAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY |
| Length | 165 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | induction of immune response against T. gondii |
| Name of receptor | Toll-like receptor 10 (TLR10) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | monocyte/macrophages |
| Domain | Cell Surface (Exogenous) |
| Sequence of Receptor | Q6R5P0.fasta |
| Swiss prot ID | Q6R5P0 |
| Length Of Receptor | 926 |
| Function | induces the release of interleukin 12 against T. gondii infected mice |
| Assay used | NA |
| PMID | 24830024 |
| Year of Publication | 2014 |
| Pubchem assay | Pubchem_assay |
| Primary information |
|---|
| PRRID | PRRID_1592 |
| Ligand Name | profilin-like protein |
| Source | T. gondii (others) |
| Sequence of ligand | MSDWDPVVKEWLVDTGYCCAGGIANVSAEDGVVFAAAADDDDGWSKLYKDDHEEDTIGEDGNACGKVSINEASTIKAAVDDGSAPNGVWIGGQKYKVVRPEKGFEYNDCTFDITMCARSKGGAHLIKTPNGSIVIALYDEEKEQDKGNSRTSALAFAEYLHQSGY |
| Length | 165 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | induction of immune response against T. gondii |
| Name of receptor | Toll-like receptor 10 (TLR10) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Mice |
| Localization | monocyte/macrophages |
| Domain | Cell Surface (Exogenous) |
| Sequence of Receptor | Q6R5P0.fasta |
| Swiss prot ID | Q6R5P0 |
| Length Of Receptor | 926 |
| Function | induces the release of interleukin 12 against T. gondii infected mice |
| Assay used | NA |
| PMID | 24830024 |
| Year of Publication | 2014 |
| Pubchem assay | Pubchem_assay |