Primary information |
---|
PRRID | PRRID_1330 |
Ligand Name | HMGB1 |
Source | Human (others) |
Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
Length | 215 |
Type | Protein |
Occurence | Natural |
Role of Ligand | play an important role in infectious inflammatory responses. |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Mice |
Localization | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte |
Domain | Cell Surface (Exogenous) |
Sequence of Receptor | O00206.fasta |
Swiss prot ID | O00206 |
Length Of Receptor | 839 |
Function | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system |
Assay used | NA |
PMID | 24830024 |
Year of Publication | 2014 |
Pubchem assay | Pubchem_assay |
Primary information |
---|
PRRID | PRRID_1330 |
Ligand Name | HMGB1 |
Source | Human (others) |
Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEDDEEDEEDEEEEEEEEDEDEEEDDDDE |
Length | 215 |
Type | Protein |
Occurence | Natural |
Role of Ligand | play an important role in infectious inflammatory responses. |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Mice |
Localization | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte |
Domain | Cell Surface (Exogenous) |
Sequence of Receptor | O00206.fasta |
Swiss prot ID | O00206 |
Length Of Receptor | 839 |
Function | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system |
Assay used | NA |
PMID | 24830024 |
Year of Publication | 2014 |
Pubchem assay | Pubchem_assay |