Primary information |
---|
PRRID | PRRID_1333 |
Ligand Name | HMGB1 |
Source | pulmonary vascular cells (e.g., endothelial cells) (others) |
Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
Length | 215 |
Type | Protein |
Occurence | Natural |
Role of Ligand | released in responses to local stresses (hypoxia or inflammation) |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Human Platelets |
Localization | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte |
Domain | Leucine-rich Repeat (LRR) Domain |
Sequence of Receptor | Q7L0X0.fasta |
Swiss prot ID | Q7L0X0 |
Length Of Receptor | 811 |
Function | TLR4 is expressed on platelets which mediates inflammatory and immune responses in a variety of diseases including PAH (pulmonary arterial hypertension) |
Assay used | NA |
PMID | 24812346 |
Year of Publication | 2014 |
Pubchem assay | Pubchem_assay |
Primary information |
---|
PRRID | PRRID_1333 |
Ligand Name | HMGB1 |
Source | pulmonary vascular cells (e.g., endothelial cells) (others) |
Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
Length | 215 |
Type | Protein |
Occurence | Natural |
Role of Ligand | released in responses to local stresses (hypoxia or inflammation) |
Name of receptor | Toll-like receptor 4 (TLR4) |
Type of receptor | Toll-like receptor (TLR) |
Source | Human Platelets |
Localization | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte |
Domain | Leucine-rich Repeat (LRR) Domain |
Sequence of Receptor | Q7L0X0.fasta |
Swiss prot ID | Q7L0X0 |
Length Of Receptor | 811 |
Function | TLR4 is expressed on platelets which mediates inflammatory and immune responses in a variety of diseases including PAH (pulmonary arterial hypertension) |
Assay used | NA |
PMID | 24812346 |
Year of Publication | 2014 |
Pubchem assay | Pubchem_assay |