| Primary information |
|---|
| PRRID | PRRID_1333 |
| Ligand Name | HMGB1 |
| Source | pulmonary vascular cells (e.g., endothelial cells) (others) |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | released in responses to local stresses (hypoxia or inflammation) |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human Platelets |
| Localization | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | Q7L0X0.fasta |
| Swiss prot ID | Q7L0X0 |
| Length Of Receptor | 811 |
| Function | TLR4 is expressed on platelets which mediates inflammatory and immune responses in a variety of diseases including PAH (pulmonary arterial hypertension) |
| Assay used | NA |
| PMID | 24812346 |
| Year of Publication | 2014 |
| Pubchem assay | Pubchem_assay |
| Primary information |
|---|
| PRRID | PRRID_1333 |
| Ligand Name | HMGB1 |
| Source | pulmonary vascular cells (e.g., endothelial cells) (others) |
| Sequence of ligand | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE |
| Length | 215 |
| Type | Protein |
| Occurence | Natural |
| Role of Ligand | released in responses to local stresses (hypoxia or inflammation) |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human Platelets |
| Localization | monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte |
| Domain | Leucine-rich Repeat (LRR) Domain |
| Sequence of Receptor | Q7L0X0.fasta |
| Swiss prot ID | Q7L0X0 |
| Length Of Receptor | 811 |
| Function | TLR4 is expressed on platelets which mediates inflammatory and immune responses in a variety of diseases including PAH (pulmonary arterial hypertension) |
| Assay used | NA |
| PMID | 24812346 |
| Year of Publication | 2014 |
| Pubchem assay | Pubchem_assay |