Please click on the ID to see detailed information about each entry.
The total number entries retrieved from this search are| ID | Sequence | Name | Nature of peptide or cargo | Assay | Tissue permeability | Tissue Sample | PUBMED ID |
|---|---|---|---|---|---|---|---|
| 1301 | SYSMEHFRWGKPV | α-Melanocyte stimulating hormone (MSH) | Controls pigmentary changes in many vertebrates and melanin synthesis within epidermal melanocytes is responsible for melanin pigmentation of the skin, hair, and feathers in man, birds and other mammals. | Light and electron microscopy | 10-7 and 10-8 concentrations turned yellow hair brown | Melanotropin dose was applied on the shaved skin of C57BL/6AY mice which stimulated the yellow hair to turn yellow which was observed at other untouched areas proving systemic effect | 3684299 |
| 1302 | SYS-Nle-EHfRWGKPV | [Nle4, D-Phe7]-alpha-MSH | The analogue is superpotent, being 10- 1000 times more active than the native hormone | Light and electron microscopy | 10-7 to 10-12 concentrations turned yellow hair brown | Melanotropin dose was applied on the shaved skin of C57BL/6AY mice which stimulated the yellow hair to turn yellow which was observed at other untouched areas proving systemic effect | 3684299 |
| 1303 | Nle-EHfRWGK | [Nle4, D-Phe7]-alpha-MSH4-11 | Not mentioned | Light and electron microscopy | 10-8 to 10-14 concentrations turned yellow hair brown | Melanotropin dose was applied on the shaved skin of C57BL/6AY mice which stimulated the yellow hair to turn yellow which was observed at other untouched areas proving systemic effect | 3684299 |
| 1304 | Nle-EHfRWG | [Nle4, D-Phe7]-alpha-MSH4-10 | Not mentioned | Light and electron microscopy | 10-8 to 10-14 concentrations turned yellow hair brown | Melanotropin dose was applied on the shaved skin of C57BL/6AY mice which stimulated the yellow hair to turn yellow which was observed at other untouched areas proving systemic effect | 3684299 |
| 1305 | SYSMEHFRWGKPV | Alpha-MSH (melanocyte-stimulating hormone) | Stimulates melanogenesis | Electron microscopy and Light microscopy | Concentrations (10-7 M-10-15 M) induced the emergent hairs to become brown at the sites of application. | dorsal trunk of mice (C57BL/6JA y) | 3624899 |
| 1306 | SYS-Nle-EHfRWGKPV | (Nle4, D-Phe7]-α-MSH | the melanotropin analogs stimulated follicular eumelanogenesis when applied topically to the skin of mice | Electron microscopy and Light microscopy | Concentrations (10-7 M-10-15 M) induced the emergent hairs to become brown at the sites of application. | dorsal trunk of mice (C57BL/6JA y) | 3624899 |
| 1307 | Nle-EHfFRWGK | Ac-[Nle4, D-Phe7]-α- MSH4–11-NH2 | the melanotropin analogs stimulated follicular eumelanogenesis when applied topically to the skin of mice | Electron microscopy and Light microscopy | Concentrations (10-7 M-10-15 M) induced the emergent hairs to become brown at the sites of application. | dorsal trunk of mice (C57BL/6JA y) | 3624899 |
| 1308 | Nle-EH-FRWG | Ac-[Nle4, D-Phe7]-α-MSH4–10-NH2 | the melanotropin analogs stimulated follicular eumelanogenesis when applied topically to the skin of mice | Electron microscopy and Light microscopy | Concentrations (10-7 M-10-15 M) induced the emergent hairs to become brown at the sites of application. | dorsal trunk of mice (C57BL/6JA y) | 3624899 |
| 1309 | SYSMEHFRWGKPV | α-Melanocyte stimulating hormone (MSH) | Controls pigmentary changes in many vertebrates and melanin synthesis within epidermal melanocytes is responsible for melanin pigmentation of the skin, hair, and feathers in man, birds and other mammals. | Electron microscopic examination | Minimal effective dose=10-8to10-9M. It stimulated eumelanogenesis in all hair emerging from the areas previously plucked. | Posterior dorsum of mice (C57BL/6JA y) | 3573985 |
| 1310 | SYS-Nle-EHfRWGKPV | (Nle4, D-Phe7)-a-MSH | The analogue is superpotent, being 10- 1000 times more active than the native hormone | Electron microscopic examination | Minimal effective dose=10-12M. It is transdermally delivered systemically to hair follicles throughout the body to induce follicular melanogenesis. Microscopic examination revealed eumelanin within hair bulbs by 24 hours after topical application of the analogue. | Posterior dorsum of mice (C57BL/6JA y) | 3573985 |
| 1311 | SYS-Nle-EHfRWGKPV | [Nle4, D-Phe7]-alpha-MSH | A superpotent(10-1000 times) analogue of alpha-melanocyte stimulating hormone, it causes a very long lasting stimulation of melanocytes in vitro and in vivo, its nonbiodegradeable and it is resistant to enzymatic inactivation by sera, brain enzymes or purified proteolytic enzymes. | Frog Skin Bioassay | Percent positive samples of transdermal delivery :65% (15/23) | Full thickness skin samples (approximately 1 and a half" in diameter) were removed from the trunk area of either black or yellow adult C57BL/6JAy mice killed by cervical dislocation | 2845208 |
| 1312 | SYS-Nle-EHfRWGKPV | [Nle4, D-Phe7]-alpha-MSH | A superpotent(10-1000 times) analogue of alpha-melanocyte stimulating hormone, it causes a very long lasting stimulation of melanocytes in vitro and in vivo, its nonbiodegradeable and it is resistant to enzymatic inactivation by sera, brain enzymes or purified proteolytic enzymes. | Radioimmunoassay | Percent positive samples of transdermal delivery :85% (11/13) | Full thickness skin samples (approximately 1 and a half" in diameter) were removed from the trunk area of either black or yellow adult C57BL/6JAy mice killed by cervical dislocation | 2845208 |
| 1313 | SYS-Nle-EHfRWGKPV | [Nle4, D-Phe7]-alpha-MSH | A superpotent(10-1000 times) analogue of alpha-melanocyte stimulating hormone, it causes a very long lasting stimulation of melanocytes in vitro and in vivo, its nonbiodegradeable and it is resistant to enzymatic inactivation by sera, brain enzymes or purified proteolytic enzymes. | Frog Skin Bioassay | Percent positive samples of transdermal delivery :6.6% (1/15) | Full thickness skin samples (approximately 1 and a half" in diameter) were removed from the trunk area of mature Sprague Dawley rats. | 2845208 |
| 1314 | SYS-Nle-EHfRWGKPV | [Nle4, D-Phe7]-alpha-MSH | A superpotent(10-1000 times) analogue of alpha-melanocyte stimulating hormone, it causes a very long lasting stimulation of melanocytes in vitro and in vivo, its nonbiodegradeable and it is resistant to enzymatic inactivation by sera, brain enzymes or purified proteolytic enzymes. | Radioimmunoassay | Percent positive samples of transdermal delivery :11.8% (2/17) | Full thickness skin samples (approximately 1 and a half" in diameter) were removed from the trunk area of mature Sprague Dawley rats. | 2845208 |
| 1315 | SYS-Nle-EHfRWGKPV | [Nle4, D-Phe7]-alpha-MSH | A superpotent(10-1000 times) analogue of alpha-melanocyte stimulating hormone, it causes a very long lasting stimulation of melanocytes in vitro and in vivo, its nonbiodegradeable and it is resistant to enzymatic inactivation by sera, brain enzymes or purified proteolytic enzymes. | Frog Skin Bioassay, radioimmunoassay and microscopy | Transdermal delivery of 0.05% | Full thickness skin samples (approximately 1 and a half" in diameter) were removed from the trunk area of either black or yellow adult C57BL/6JAy mice killed by cervical dislocation | 2845208 |
| 1316 | SYS-Nle-EHfRWGKPV | [Nle4, D-Phe7]-alpha-MSH | A superpotent(10-1000 times) analogue of alpha-melanocyte stimulating hormone, it causes a very long lasting stimulation of melanocytes in vitro and in vivo, its nonbiodegradeable and it is resistant to enzymatic inactivation by sera, brain enzymes or purified proteolytic enzymes. | Frog Skin Bioassay, radioimmunoassay and microscopy | Transdermal delivery of 0.08% | Full thickness skin samples (approximately 1 and a half" in diameter) were removed from the trunk area of either black or yellow adult C57BL/6JAy mice killed by cervical dislocation | 2845208 |
| 1317 | SYSMEHFRWGKPV | α-Melanocyte stimulating hormone (MSH) | It acts as an antagonist to interleukin 1 (IL-1) bioactivities such as inhibition of fever production, thymocyte proliferation, and inhibition of release of acute phase inflammatory molecules from the liver. | Indirect immunoperoxidase and indirect immunofluorescence staining | Phenotypic markers: Ia=408 ± 19 , Thy1.2=340 ± 15 and Asialo GM-1=465 ± 18 | Dorsal surface of the ear of five to seven-wk-old male C57BL/6 (H-2b) mice | 2550560 |
| 1318 | TSEKSQTPLVTL | des-enkephalin-ƴ-endorphin(DEƴE) | A highly potent neuropeptide which has been implicated in schizophrenic psychoses | Radioactive assay | Permeability coefficient:86±30*105 cm/hour, flux of radiolabelled material: 1130±400*1012 mol/hour/cm2 | Deglycerinized human cadaver skin | 2533571 |
| 1319 | TSEKSQTPLVTL | des-enkephalin-ƴ-endorphin(DEƴE) | A highly potent neuropeptide which has been implicated in schizophrenic psychoses | Radioactive assay | Permeability coefficient:1.2±0.4*105 cm/hour, flux of radiolabelled material: 1.1±0.4*1012 mol/hour/cm2 | Human stratum corneum | 2533571 |
| 1320 | TSEKSQTPLVTL | des-enkephalin-ƴ-endorphin(DEƴE) | A highly potent neuropeptide which has been implicated in schizophrenic psychoses | Radioactive assay | Permeability coefficient:1.9*105 cm/hour, flux of radiolabelled material:2.7*1012 mol/hour/cm2 | Human stratum corneum | 2533571 |
| 1321 | TSEKSQTPLVTL | des-enkephalin-ƴ-endorphin(DEƴE) | A highly potent neuropeptide which has been implicated in schizophrenic psychoses | Radioactive assay | Permeability coefficient:4.7*105 cm/hour, flux of radiolabelled material:4.2*1012 mol/hour/cm2 | Human stratum corneum | 2533571 |
| 1322 | A-isoGln-A | Muramyl tripeptide-phosphatidylethanolamine (MTP-PE, CGP 19835) | MTP-PE is a stimulator of innate immunity and a synthetic molecule derived from muramyl dipeptide (MDP). MTP-PE results from the covalent addition of alanin and dipalmitoyl phosphatidyl ethanolamine to MDP , which is a peptidoglycan found in Gram-positive and Gram-negative bacterial cell walls. | Plaque reduction assay using calf kidney cells | Initial symptomatology to Herpes simplex 2/Angelotti is milder, the local disease is significantly mitigated by MTP-PE (P≤ 0.05). Recovery is accelerated and animal becomes asymptomatic by day 15-20. | Tif:DHP Dunking-Hartley Pirbright guinea pigs. After slight abrasion of the vaginal mucosa, a piece of fibrin foam impregnated with virus suspension was introduced into the vagina. | 2433236 |
| 1323 | A-isoGln-A | Muramyl tripeptide-phosphatidylethanolamine (MTP-PE, CGP 19835) | MTP-PE is a stimulator of innate immunity and a synthetic molecule derived from muramyl dipeptide (MDP). MTP-PE results from the covalent addition of alanin and dipalmitoyl phosphatidyl ethanolamine to MDP , which is a peptidoglycan found in Gram-positive and Gram-negative bacterial cell walls. | Plaque reduction assay using calf kidney cells | Initial symptomatology to Herpes simplex 2/Alabama is milder, the local disease is significantly mitigated by MTP-PE (P≤ 0.05). Recovery is accelerated and animal becomes asymptomatic by day 15-20. | Tif:DHP Dunking-Hartley Pirbright guinea pigs. After slight abrasion of the vaginal mucosa, a piece of fibrin foam impregnated with virus suspension was introduced into the vagina. | 2433236 |
| 1324 | A-isoGln-A | Muramyl tripeptide-phosphatidylethanolamine (MTP-PE, CGP 19835) | MTP-PE is a stimulator of innate immunity and a synthetic molecule derived from muramyl dipeptide (MDP). MTP-PE results from the covalent addition of alanin and dipalmitoyl phosphatidyl ethanolamine to MDP , which is a peptidoglycan found in Gram-positive and Gram-negative bacterial cell walls. | Plaque reduction assay using calf kidney cells | Initial symptomatology to Herpes simplex 2/MS is milder, the local disease is significantly mitigated by MTP-PE (P≤ 0.05). Recovery is accelerated and animal becomes asymptomatic by day 15-20. | Tif:DHP Dunking-Hartley Pirbright guinea pigs. After slight abrasion of the vaginal mucosa, a piece of fibrin foam impregnated with virus suspension was introduced into the vagina. | 2433236 |
| 1399 | T | Capsaicin | Capsaicin, the pungent ingredient of red peppers, when applied into the nasal mucosa induces violent sneezing, vasodilation and increases vascular permeability. | Visual analogue scale method was used to measure burning and painful sensation on application of capsaicin. | The application of capsaicin into the human nasal mucosa was immediately followed by a painful sensation that was described by all the subjects as burning. A variable number of sneezes (from I up to 8) also occurred. | Human nasal mucosa | 3370386 |
| 1400 | T | Capsaicin | Capsaicin activates sensory nerve endings in the nose and the paranasal sinuses, thereby stimulating protective reflexes involved in sneezing and in increased vasopermeability and stimulate mucociliary activity | The amount of nasal mucosa secreted in response to capsaicin was weighed. | Capsaicin stimulated the secretion of nasal fluid in a dose-dependent manner when administered as a single dose. | Nasal mucosa of rats | 2480171 |
| 1402 | (Chain A: GIVEQCCTSICSLYQLENYCN) (Chain B: FVNQHLCGSHLVEALYLVCGERGFFYTPKT) | Insulin | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. | Chloride in the sweat determined by titration with a Cotiove chloridometer | Control/Cystic fibrosis patients: 14.81±2.39/79.70±3.59(Vehicle treated) and 14.47±2.66/68.07±3.29(Insulin treated) | Stratum corneum of arm of cystic fibrosis patients | 1144451 |
| 1403 | (Chain A: GIVEQCCTSICSLYQLENYCN) (Chain B: FVNQHLCGSHLVEALYLVCGERGFFYTPKT) | Insulin | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. | Chloride in the sweat determined by titration with a Cotiove chloridometer | Control/Cystic fibrosis patients: 14.81±2.39/16.03±2.34(Vehicle treated) and 14.47±2.66/11.52±1.28(Insulin treated) | Stratum corneum of arm of cystic fibrosis patients | 1144451 |
| 1405 | rPKPQQwFwLL | Spantide | Effectively prevents the miosis and the disruption of the blood-aqueous barrier consequent to ocular injury. | Radioimmunoassay, HPLC | Systemic uptake corresponds to a serum concentration peak of 4.5*10-9M after 15 minutes | Left eye of pigmented rabbits of either sex and weighing 2-3 kg | 1689665 |
| 1406 | rPKPQQwFwLL | Spantide | Effectively prevents the miosis and the disruption of the blood-aqueous barrier consequent to ocular injury. | Radioimmunoassay, HPLC | Systemic uptake corresponds to a serum concentration peak of 1*10-8M after 15 minutes and intraoccular uptake corresponded to a plateau at 140-150ng/ml for 1-3 hours after completion of application | Left eye of pigmented rabbits of either sex and weighing 2-3 kg | 1689665 |
| 1407 | rPKPQQwFwLL | Spantide | Effectively prevents the miosis and the disruption of the blood-aqueous barrier consequent to ocular injury. | Radioimmunoassay, HPLC | Systemic uptake corresponds to a serum concentration peak of 1*10-7M after 15 minutes and intraoccular uptake corresponded to a plateau at 1.3-1.5µg/ml for 90-240 minutes after completion of application giving an approximate concentration of 10m6 M in the aqueous humor. | Left eye of pigmented rabbits of either sex and weighing 2-3 kg | 1689665 |
| 1436 | ACDTATCVTHRLAGL LSRSGGVVKNNFVPT NVGSKAF | α-CGRP (α-calcitonin gene-related peptide) | Specific binding sites for CGRP have been demonstrated both in the brain and in peripheral target tissues, where CGRP has been shown to act through a CAMP-dependent mechanism | Intraocular pressure (IOP) calculated electromanometrically, blood-aqueous barrier, pupil size, blood pressure and cyclic AMP (CAMP) content in the aqueous humour of rabbits via 125I-radioimmunoassay | IOP:Control=1.8mmHg, Neutral formaldehyde=From the baseline of 16.9±1.5 it rose by 27.3±3.8mmHg in 15.1±1.8 minutes, CGRP(0.5µg)=From the baseline of 18.5±1.1 it rose by 11.8±2.3mmHg in 15.0±2 minutes; Mean arterial blood pressure:Control=94±12/101±10(before), Formaldehyde=92±5/95±3(before), CGRP=94±5/98±4(before); cAMP after 30 minutes:Control=16.3±3.6pmol/ml, Formaldehyde right eye=88.5±35pmol/ml, Formaldehyde left e | Albino rabbits of both sexes weighing 2.2-3.1 kg were used. Right eye=Contralateral eye and left eye=Experimental. | 2842178 |
| 1437 | ACDTATCVTHRLAGL LSRSGGVVKNNFVPT NVGSKAF | α-CGRP (α-calcitonin gene-related peptide) | Specific binding sites for CGRP have been demonstrated both in the brain and in peripheral target tissues, where CGRP has been shown to act through a CAMP-dependent mechanism | Intraocular pressure (IOP) calculated electromanometrically, blood-aqueous barrier, pupil size, blood pressure and cyclic AMP (CAMP) content in the aqueous humour of rabbits via 125I-radioimmunoassay | IOP:Control=1.8mmHg, Neutral formaldehyde=From the baseline of 16.9±1.5 it rose by 27.3±3.8mmHg in 15.1±1.8 minutes, CGRP(2.0µg)=From the baseline of 17.5±0.9 it rose by 19.3±3.6mmHg in 6.3±1.5 minutes; Mean arterial blood pressure:Control=94±12/101±10(before), Formaldehyde=92±5/95±3(before), CGRP=85±6/104±5(before); cAMP after 30 minutes:Control=16.3±3.6pmol/ml, Formaldehyde right eye=88.5±35pmol/ml, Formaldehyde left | Albino rabbits of both sexes weighing 2.2-3.1 kg were used. Right eye=Contralateral eye and left eye=Experimental. | 2842178 |
| 1444 | YGGFL | Leucine enkephalin | Leu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | Radioactive determination | Fluid: Tears- intact peptide=800pmoles/ml fluid, degraded peptide=2250pmoles/ml fluid, Percent of recovered enkephalin attributable to degradation products=33.7% | Superior limbus of both eyes of each male, albino New Zealand rabbits | 3503119 |
| 1445 | YGGFL | Leucine enkephalin | Leu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | Radioactive determination | Fluid: Tears- intact peptide=250pmoles/ml fluid, degraded peptide=500pmoles/ml fluid, Percent of recovered enkephalin attributable to degradation products=59% | Superior limbus of both eyes of each male, albino New Zealand rabbits | 3503119 |
| 1446 | YGGFL | Leucine enkephalin | Leu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | Radioactive determination | Tissue: Conjunctiva- intact peptide=135pmoles/g tissue, degraded peptide=172pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=76.7% | Superior limbus of both eyes of each male, albino New Zealand rabbits | 3503119 |
| 1447 | YGGFL | Leucine enkephalin | Leu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | Radioactive determination | Tissue: Conjunctiva- intact peptide=175pmoles/g tissue, degraded peptide=185pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=85% | Superior limbus of both eyes of each male, albino New Zealand rabbits | 3503119 |
| 1448 | YGGFL | Leucine enkephalin | Leu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | Radioactive determination | Tissue: Conjunctiva- intact peptide=180pmoles/g tissue, degraded peptide=230pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=81.7% | Superior limbus of both eyes of each male, albino New Zealand rabbits | 3503119 |
| 1449 | YGGFL | Leucine enkephalin | Leu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | Radioactive determination | Tissue: Corneal epithelium- intact peptide=270pmoles/g tissue, degraded peptide=300pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=86.1% | Superior limbus of both eyes of each male, albino New Zealand rabbits | 3503119 |
| 1450 | YGGFL | Leucine enkephalin | Leu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | Radioactive determination | Tissue: Corneal epithelium- intact peptide=655pmoles/g tissue, degraded peptide=710pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=91.6% | Superior limbus of both eyes of each male, albino New Zealand rabbits | 3503119 |
| 1451 | YGGFL | Leucine enkephalin | Leu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | Radioactive determination | Tissue: Corneal epithelium- intact peptide=885pmoles/g tissue, degraded peptide=1120pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=72.1% | Superior limbus of both eyes of each male, albino New Zealand rabbits | 3503119 |
| 1452 | YGGFL | Leucine enkephalin | Leu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | Radioactive determination | Tissue: Corneal stroma- intact peptide=28pmoles/g tissue, degraded peptide=31pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=87.9% | Superior limbus of both eyes of each male, albino New Zealand rabbits | 3503119 |
| 1453 | YGGFL | Leucine enkephalin | Leu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | Radioactive determination | Tissue: Corneal stroma- intact peptide=81pmoles/g tissue, degraded peptide=92pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=84.2% | Superior limbus of both eyes of each male, albino New Zealand rabbits | 3503119 |
| 1454 | YGGFL | Leucine enkephalin | Leu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | Radioactive determination | Tissue: Corneal stroma- intact peptide=37.5pmoles/g tissue, degraded peptide=48pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=96.6% | Superior limbus of both eyes of each male, albino New Zealand rabbits | 3503119 |
| 1455 | YGGFL | Leucine enkephalin | Leu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | Radioactive determination | Tissue: Iris-Ciliary Body- intact peptide=5.2pmoles/g tissue, degraded peptide=6.5pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=81.0% | Superior limbus of both eyes of each male, albino New Zealand rabbits | 3503119 |
| 1456 | YGGFL | Leucine enkephalin | Leu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | Radioactive determination | Tissue: Iris-Ciliary Body- intact peptide=8.3pmoles/g tissue, degraded peptide=9pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=98.1% | Superior limbus of both eyes of each male, albino New Zealand rabbits | 3503119 |
| 1457 | YGGFL | Leucine enkephalin | Leu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | Radioactive determination | Tissue: Iris-Ciliary Body- intact peptide=4.8pmoles/g tissue, degraded peptide=5.5pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=96.8% | Superior limbus of both eyes of each male, albino New Zealand rabbits | 3503119 |
| 1458 | YGGFL | Leucine enkephalin | Leu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | Radioactive determination | Fluid: Aqueous humor- intact peptide=0.75pmoles/ml fluid, degraded peptide=0.9pmoles/ml fluid, Percent of recovered enkephalin attributable to degradation products=93.8% | Superior limbus of both eyes of each male, albino New Zealand rabbits | 3503119 |
| 1459 | YGGFL | Leucine enkephalin | Leu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | Radioactive determination | Fluid: Aqueous humor- intact peptide=5.4pmoles/ml fluid, degraded peptide=5.7pmoles/ml fluid, Percent of recovered enkephalin attributable to degradation products=99.0% | Superior limbus of both eyes of each male, albino New Zealand rabbits | 3503119 |
| 1460 | YGGFL | Leucine enkephalin | Leu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | Radioactive determination | Fluid: Aqueous humor- intact peptide=5.0pmoles/ml fluid, degraded peptide=5.24pmoles/ml fluid, Percent of recovered enkephalin attributable to degradation products=99.4% | Superior limbus of both eyes of each male, albino New Zealand rabbits | 3503119 |