Please click on the ID to see detailed information about each entry.
The total number entries retrieved from this search are| ID1301 | SequenceSYSMEHFRWGKPV | Nameα-Melanocyte stimulating hormone (MSH) | Nature of peptide or cargoControls pigmentary changes in many vertebrates and melanin synthesis within epidermal melanocytes is responsible for melanin pigmentation of the skin, hair, and feathers in man, birds and other mammals. | AssayLight and electron microscopy | Tissue permeability10-7 and 10-8 concentrations turned yellow hair brown | Tissue SampleMelanotropin dose was applied on the shaved skin of C57BL/6AY mice which stimulated the yellow hair to turn yellow which was observed at other untouched areas proving systemic effect | PUBMED ID3684299 |
| ID1302 | SequenceSYS-Nle-EHfRWGKPV | Name[Nle4, D-Phe7]-alpha-MSH | Nature of peptide or cargoThe analogue is superpotent, being 10- 1000 times more active than the native hormone | AssayLight and electron microscopy | Tissue permeability10-7 to 10-12 concentrations turned yellow hair brown | Tissue SampleMelanotropin dose was applied on the shaved skin of C57BL/6AY mice which stimulated the yellow hair to turn yellow which was observed at other untouched areas proving systemic effect | PUBMED ID3684299 |
| ID1303 | SequenceNle-EHfRWGK | Name[Nle4, D-Phe7]-alpha-MSH4-11 | Nature of peptide or cargoNot mentioned | AssayLight and electron microscopy | Tissue permeability10-8 to 10-14 concentrations turned yellow hair brown | Tissue SampleMelanotropin dose was applied on the shaved skin of C57BL/6AY mice which stimulated the yellow hair to turn yellow which was observed at other untouched areas proving systemic effect | PUBMED ID3684299 |
| ID1304 | SequenceNle-EHfRWG | Name[Nle4, D-Phe7]-alpha-MSH4-10 | Nature of peptide or cargoNot mentioned | AssayLight and electron microscopy | Tissue permeability10-8 to 10-14 concentrations turned yellow hair brown | Tissue SampleMelanotropin dose was applied on the shaved skin of C57BL/6AY mice which stimulated the yellow hair to turn yellow which was observed at other untouched areas proving systemic effect | PUBMED ID3684299 |
| ID1305 | SequenceSYSMEHFRWGKPV | NameAlpha-MSH (melanocyte-stimulating hormone) | Nature of peptide or cargoStimulates melanogenesis | AssayElectron microscopy and Light microscopy | Tissue permeabilityConcentrations (10-7 M-10-15 M) induced the emergent hairs to become brown at the sites of application. | Tissue Sampledorsal trunk of mice (C57BL/6JA y) | PUBMED ID3624899 |
| ID1306 | SequenceSYS-Nle-EHfRWGKPV | Name(Nle4, D-Phe7]-α-MSH | Nature of peptide or cargothe melanotropin analogs stimulated follicular eumelanogenesis when applied topically to the skin of mice | AssayElectron microscopy and Light microscopy | Tissue permeabilityConcentrations (10-7 M-10-15 M) induced the emergent hairs to become brown at the sites of application. | Tissue Sampledorsal trunk of mice (C57BL/6JA y) | PUBMED ID3624899 |
| ID1307 | SequenceNle-EHfFRWGK | NameAc-[Nle4, D-Phe7]-α- MSH4–11-NH2 | Nature of peptide or cargothe melanotropin analogs stimulated follicular eumelanogenesis when applied topically to the skin of mice | AssayElectron microscopy and Light microscopy | Tissue permeabilityConcentrations (10-7 M-10-15 M) induced the emergent hairs to become brown at the sites of application. | Tissue Sampledorsal trunk of mice (C57BL/6JA y) | PUBMED ID3624899 |
| ID1308 | SequenceNle-EH-FRWG | NameAc-[Nle4, D-Phe7]-α-MSH4–10-NH2 | Nature of peptide or cargothe melanotropin analogs stimulated follicular eumelanogenesis when applied topically to the skin of mice | AssayElectron microscopy and Light microscopy | Tissue permeabilityConcentrations (10-7 M-10-15 M) induced the emergent hairs to become brown at the sites of application. | Tissue Sampledorsal trunk of mice (C57BL/6JA y) | PUBMED ID3624899 |
| ID1309 | SequenceSYSMEHFRWGKPV | Nameα-Melanocyte stimulating hormone (MSH) | Nature of peptide or cargoControls pigmentary changes in many vertebrates and melanin synthesis within epidermal melanocytes is responsible for melanin pigmentation of the skin, hair, and feathers in man, birds and other mammals. | AssayElectron microscopic examination | Tissue permeabilityMinimal effective dose=10-8to10-9M. It stimulated eumelanogenesis in all hair emerging from the areas previously plucked. | Tissue SamplePosterior dorsum of mice (C57BL/6JA y) | PUBMED ID3573985 |
| ID1310 | SequenceSYS-Nle-EHfRWGKPV | Name(Nle4, D-Phe7)-a-MSH | Nature of peptide or cargoThe analogue is superpotent, being 10- 1000 times more active than the native hormone | AssayElectron microscopic examination | Tissue permeabilityMinimal effective dose=10-12M. It is transdermally delivered systemically to hair follicles throughout the body to induce follicular melanogenesis. Microscopic examination revealed eumelanin within hair bulbs by 24 hours after topical application of the analogue. | Tissue SamplePosterior dorsum of mice (C57BL/6JA y) | PUBMED ID3573985 |
| ID1311 | SequenceSYS-Nle-EHfRWGKPV | Name[Nle4, D-Phe7]-alpha-MSH | Nature of peptide or cargoA superpotent(10-1000 times) analogue of alpha-melanocyte stimulating hormone, it causes a very long lasting stimulation of melanocytes in vitro and in vivo, its nonbiodegradeable and it is resistant to enzymatic inactivation by sera, brain enzymes or purified proteolytic enzymes. | AssayFrog Skin Bioassay | Tissue permeabilityPercent positive samples of transdermal delivery :65% (15/23) | Tissue SampleFull thickness skin samples (approximately 1 and a half" in diameter) were removed from the trunk area of either black or yellow adult C57BL/6JAy mice killed by cervical dislocation | PUBMED ID2845208 |
| ID1312 | SequenceSYS-Nle-EHfRWGKPV | Name[Nle4, D-Phe7]-alpha-MSH | Nature of peptide or cargoA superpotent(10-1000 times) analogue of alpha-melanocyte stimulating hormone, it causes a very long lasting stimulation of melanocytes in vitro and in vivo, its nonbiodegradeable and it is resistant to enzymatic inactivation by sera, brain enzymes or purified proteolytic enzymes. | AssayRadioimmunoassay | Tissue permeabilityPercent positive samples of transdermal delivery :85% (11/13) | Tissue SampleFull thickness skin samples (approximately 1 and a half" in diameter) were removed from the trunk area of either black or yellow adult C57BL/6JAy mice killed by cervical dislocation | PUBMED ID2845208 |
| ID1313 | SequenceSYS-Nle-EHfRWGKPV | Name[Nle4, D-Phe7]-alpha-MSH | Nature of peptide or cargoA superpotent(10-1000 times) analogue of alpha-melanocyte stimulating hormone, it causes a very long lasting stimulation of melanocytes in vitro and in vivo, its nonbiodegradeable and it is resistant to enzymatic inactivation by sera, brain enzymes or purified proteolytic enzymes. | AssayFrog Skin Bioassay | Tissue permeabilityPercent positive samples of transdermal delivery :6.6% (1/15) | Tissue SampleFull thickness skin samples (approximately 1 and a half" in diameter) were removed from the trunk area of mature Sprague Dawley rats. | PUBMED ID2845208 |
| ID1314 | SequenceSYS-Nle-EHfRWGKPV | Name[Nle4, D-Phe7]-alpha-MSH | Nature of peptide or cargoA superpotent(10-1000 times) analogue of alpha-melanocyte stimulating hormone, it causes a very long lasting stimulation of melanocytes in vitro and in vivo, its nonbiodegradeable and it is resistant to enzymatic inactivation by sera, brain enzymes or purified proteolytic enzymes. | AssayRadioimmunoassay | Tissue permeabilityPercent positive samples of transdermal delivery :11.8% (2/17) | Tissue SampleFull thickness skin samples (approximately 1 and a half" in diameter) were removed from the trunk area of mature Sprague Dawley rats. | PUBMED ID2845208 |
| ID1315 | SequenceSYS-Nle-EHfRWGKPV | Name[Nle4, D-Phe7]-alpha-MSH | Nature of peptide or cargoA superpotent(10-1000 times) analogue of alpha-melanocyte stimulating hormone, it causes a very long lasting stimulation of melanocytes in vitro and in vivo, its nonbiodegradeable and it is resistant to enzymatic inactivation by sera, brain enzymes or purified proteolytic enzymes. | AssayFrog Skin Bioassay, radioimmunoassay and microscopy | Tissue permeabilityTransdermal delivery of 0.05% | Tissue SampleFull thickness skin samples (approximately 1 and a half" in diameter) were removed from the trunk area of either black or yellow adult C57BL/6JAy mice killed by cervical dislocation | PUBMED ID2845208 |
| ID1316 | SequenceSYS-Nle-EHfRWGKPV | Name[Nle4, D-Phe7]-alpha-MSH | Nature of peptide or cargoA superpotent(10-1000 times) analogue of alpha-melanocyte stimulating hormone, it causes a very long lasting stimulation of melanocytes in vitro and in vivo, its nonbiodegradeable and it is resistant to enzymatic inactivation by sera, brain enzymes or purified proteolytic enzymes. | AssayFrog Skin Bioassay, radioimmunoassay and microscopy | Tissue permeabilityTransdermal delivery of 0.08% | Tissue SampleFull thickness skin samples (approximately 1 and a half" in diameter) were removed from the trunk area of either black or yellow adult C57BL/6JAy mice killed by cervical dislocation | PUBMED ID2845208 |
| ID1317 | SequenceSYSMEHFRWGKPV | Nameα-Melanocyte stimulating hormone (MSH) | Nature of peptide or cargoIt acts as an antagonist to interleukin 1 (IL-1) bioactivities such as inhibition of fever production, thymocyte proliferation, and inhibition of release of acute phase inflammatory molecules from the liver. | AssayIndirect immunoperoxidase and indirect immunofluorescence staining | Tissue permeabilityPhenotypic markers: Ia=408 ± 19 , Thy1.2=340 ± 15 and Asialo GM-1=465 ± 18 | Tissue SampleDorsal surface of the ear of five to seven-wk-old male C57BL/6 (H-2b) mice | PUBMED ID2550560 |
| ID1318 | SequenceTSEKSQTPLVTL | Namedes-enkephalin-ƴ-endorphin(DEƴE) | Nature of peptide or cargoA highly potent neuropeptide which has been implicated in schizophrenic psychoses | AssayRadioactive assay | Tissue permeabilityPermeability coefficient:86±30*105 cm/hour, flux of radiolabelled material: 1130±400*1012 mol/hour/cm2 | Tissue SampleDeglycerinized human cadaver skin | PUBMED ID2533571 |
| ID1319 | SequenceTSEKSQTPLVTL | Namedes-enkephalin-ƴ-endorphin(DEƴE) | Nature of peptide or cargoA highly potent neuropeptide which has been implicated in schizophrenic psychoses | AssayRadioactive assay | Tissue permeabilityPermeability coefficient:1.2±0.4*105 cm/hour, flux of radiolabelled material: 1.1±0.4*1012 mol/hour/cm2 | Tissue SampleHuman stratum corneum | PUBMED ID2533571 |
| ID1320 | SequenceTSEKSQTPLVTL | Namedes-enkephalin-ƴ-endorphin(DEƴE) | Nature of peptide or cargoA highly potent neuropeptide which has been implicated in schizophrenic psychoses | AssayRadioactive assay | Tissue permeabilityPermeability coefficient:1.9*105 cm/hour, flux of radiolabelled material:2.7*1012 mol/hour/cm2 | Tissue SampleHuman stratum corneum | PUBMED ID2533571 |
| ID1321 | SequenceTSEKSQTPLVTL | Namedes-enkephalin-ƴ-endorphin(DEƴE) | Nature of peptide or cargoA highly potent neuropeptide which has been implicated in schizophrenic psychoses | AssayRadioactive assay | Tissue permeabilityPermeability coefficient:4.7*105 cm/hour, flux of radiolabelled material:4.2*1012 mol/hour/cm2 | Tissue SampleHuman stratum corneum | PUBMED ID2533571 |
| ID1322 | SequenceA-isoGln-A | NameMuramyl tripeptide-phosphatidylethanolamine (MTP-PE, CGP 19835) | Nature of peptide or cargoMTP-PE is a stimulator of innate immunity and a synthetic molecule derived from muramyl dipeptide (MDP). MTP-PE results from the covalent addition of alanin and dipalmitoyl phosphatidyl ethanolamine to MDP , which is a peptidoglycan found in Gram-positive and Gram-negative bacterial cell walls. | AssayPlaque reduction assay using calf kidney cells | Tissue permeabilityInitial symptomatology to Herpes simplex 2/Angelotti is milder, the local disease is significantly mitigated by MTP-PE (P≤ 0.05). Recovery is accelerated and animal becomes asymptomatic by day 15-20. | Tissue SampleTif:DHP Dunking-Hartley Pirbright guinea pigs. After slight abrasion of the vaginal mucosa, a piece of fibrin foam impregnated with virus suspension was introduced into the vagina. | PUBMED ID2433236 |
| ID1323 | SequenceA-isoGln-A | NameMuramyl tripeptide-phosphatidylethanolamine (MTP-PE, CGP 19835) | Nature of peptide or cargoMTP-PE is a stimulator of innate immunity and a synthetic molecule derived from muramyl dipeptide (MDP). MTP-PE results from the covalent addition of alanin and dipalmitoyl phosphatidyl ethanolamine to MDP , which is a peptidoglycan found in Gram-positive and Gram-negative bacterial cell walls. | AssayPlaque reduction assay using calf kidney cells | Tissue permeabilityInitial symptomatology to Herpes simplex 2/Alabama is milder, the local disease is significantly mitigated by MTP-PE (P≤ 0.05). Recovery is accelerated and animal becomes asymptomatic by day 15-20. | Tissue SampleTif:DHP Dunking-Hartley Pirbright guinea pigs. After slight abrasion of the vaginal mucosa, a piece of fibrin foam impregnated with virus suspension was introduced into the vagina. | PUBMED ID2433236 |
| ID1324 | SequenceA-isoGln-A | NameMuramyl tripeptide-phosphatidylethanolamine (MTP-PE, CGP 19835) | Nature of peptide or cargoMTP-PE is a stimulator of innate immunity and a synthetic molecule derived from muramyl dipeptide (MDP). MTP-PE results from the covalent addition of alanin and dipalmitoyl phosphatidyl ethanolamine to MDP , which is a peptidoglycan found in Gram-positive and Gram-negative bacterial cell walls. | AssayPlaque reduction assay using calf kidney cells | Tissue permeabilityInitial symptomatology to Herpes simplex 2/MS is milder, the local disease is significantly mitigated by MTP-PE (P≤ 0.05). Recovery is accelerated and animal becomes asymptomatic by day 15-20. | Tissue SampleTif:DHP Dunking-Hartley Pirbright guinea pigs. After slight abrasion of the vaginal mucosa, a piece of fibrin foam impregnated with virus suspension was introduced into the vagina. | PUBMED ID2433236 |
| ID1399 | SequenceT | NameCapsaicin | Nature of peptide or cargoCapsaicin, the pungent ingredient of red peppers, when applied into the nasal mucosa induces violent sneezing, vasodilation and increases vascular permeability. | AssayVisual analogue scale method was used to measure burning and painful sensation on application of capsaicin. | Tissue permeabilityThe application of capsaicin into the human nasal mucosa was immediately followed by a painful sensation that was described by all the subjects as burning. A variable number of sneezes (from I up to 8) also occurred. | Tissue SampleHuman nasal mucosa | PUBMED ID3370386 |
| ID1400 | SequenceT | NameCapsaicin | Nature of peptide or cargoCapsaicin activates sensory nerve endings in the nose and the paranasal sinuses, thereby stimulating protective reflexes involved in sneezing and in increased vasopermeability and stimulate mucociliary activity | AssayThe amount of nasal mucosa secreted in response to capsaicin was weighed. | Tissue permeabilityCapsaicin stimulated the secretion of nasal fluid in a dose-dependent manner when administered as a single dose. | Tissue SampleNasal mucosa of rats | PUBMED ID2480171 |
| ID1402 | Sequence(Chain A: GIVEQCCTSICSLYQLENYCN) (Chain B: FVNQHLCGSHLVEALYLVCGERGFFYTPKT) | NameInsulin | Nature of peptide or cargoInsulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. | AssayChloride in the sweat determined by titration with a Cotiove chloridometer | Tissue permeabilityControl/Cystic fibrosis patients: 14.81±2.39/79.70±3.59(Vehicle treated) and 14.47±2.66/68.07±3.29(Insulin treated) | Tissue SampleStratum corneum of arm of cystic fibrosis patients | PUBMED ID1144451 |
| ID1403 | Sequence(Chain A: GIVEQCCTSICSLYQLENYCN) (Chain B: FVNQHLCGSHLVEALYLVCGERGFFYTPKT) | NameInsulin | Nature of peptide or cargoInsulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. | AssayChloride in the sweat determined by titration with a Cotiove chloridometer | Tissue permeabilityControl/Cystic fibrosis patients: 14.81±2.39/16.03±2.34(Vehicle treated) and 14.47±2.66/11.52±1.28(Insulin treated) | Tissue SampleStratum corneum of arm of cystic fibrosis patients | PUBMED ID1144451 |
| ID1405 | SequencerPKPQQwFwLL | NameSpantide | Nature of peptide or cargoEffectively prevents the miosis and the disruption of the blood-aqueous barrier consequent to ocular injury. | AssayRadioimmunoassay, HPLC | Tissue permeabilitySystemic uptake corresponds to a serum concentration peak of 4.5*10-9M after 15 minutes | Tissue SampleLeft eye of pigmented rabbits of either sex and weighing 2-3 kg | PUBMED ID1689665 |
| ID1406 | SequencerPKPQQwFwLL | NameSpantide | Nature of peptide or cargoEffectively prevents the miosis and the disruption of the blood-aqueous barrier consequent to ocular injury. | AssayRadioimmunoassay, HPLC | Tissue permeabilitySystemic uptake corresponds to a serum concentration peak of 1*10-8M after 15 minutes and intraoccular uptake corresponded to a plateau at 140-150ng/ml for 1-3 hours after completion of application | Tissue SampleLeft eye of pigmented rabbits of either sex and weighing 2-3 kg | PUBMED ID1689665 |
| ID1407 | SequencerPKPQQwFwLL | NameSpantide | Nature of peptide or cargoEffectively prevents the miosis and the disruption of the blood-aqueous barrier consequent to ocular injury. | AssayRadioimmunoassay, HPLC | Tissue permeabilitySystemic uptake corresponds to a serum concentration peak of 1*10-7M after 15 minutes and intraoccular uptake corresponded to a plateau at 1.3-1.5µg/ml for 90-240 minutes after completion of application giving an approximate concentration of 10m6 M in the aqueous humor. | Tissue SampleLeft eye of pigmented rabbits of either sex and weighing 2-3 kg | PUBMED ID1689665 |
| ID1436 | SequenceACDTATCVTHRLAGL LSRSGGVVKNNFVPT NVGSKAF | Nameα-CGRP (α-calcitonin gene-related peptide) | Nature of peptide or cargoSpecific binding sites for CGRP have been demonstrated both in the brain and in peripheral target tissues, where CGRP has been shown to act through a CAMP-dependent mechanism | AssayIntraocular pressure (IOP) calculated electromanometrically, blood-aqueous barrier, pupil size, blood pressure and cyclic AMP (CAMP) content in the aqueous humour of rabbits via 125I-radioimmunoassay | Tissue permeabilityIOP:Control=1.8mmHg, Neutral formaldehyde=From the baseline of 16.9±1.5 it rose by 27.3±3.8mmHg in 15.1±1.8 minutes, CGRP(0.5µg)=From the baseline of 18.5±1.1 it rose by 11.8±2.3mmHg in 15.0±2 minutes; Mean arterial blood pressure:Control=94±12/101±10(before), Formaldehyde=92±5/95±3(before), CGRP=94±5/98±4(before); cAMP after 30 minutes:Control=16.3±3.6pmol/ml, Formaldehyde right eye=88.5±35pmol/ml, Formaldehyde left e | Tissue SampleAlbino rabbits of both sexes weighing 2.2-3.1 kg were used. Right eye=Contralateral eye and left eye=Experimental. | PUBMED ID2842178 |
| ID1437 | SequenceACDTATCVTHRLAGL LSRSGGVVKNNFVPT NVGSKAF | Nameα-CGRP (α-calcitonin gene-related peptide) | Nature of peptide or cargoSpecific binding sites for CGRP have been demonstrated both in the brain and in peripheral target tissues, where CGRP has been shown to act through a CAMP-dependent mechanism | AssayIntraocular pressure (IOP) calculated electromanometrically, blood-aqueous barrier, pupil size, blood pressure and cyclic AMP (CAMP) content in the aqueous humour of rabbits via 125I-radioimmunoassay | Tissue permeabilityIOP:Control=1.8mmHg, Neutral formaldehyde=From the baseline of 16.9±1.5 it rose by 27.3±3.8mmHg in 15.1±1.8 minutes, CGRP(2.0µg)=From the baseline of 17.5±0.9 it rose by 19.3±3.6mmHg in 6.3±1.5 minutes; Mean arterial blood pressure:Control=94±12/101±10(before), Formaldehyde=92±5/95±3(before), CGRP=85±6/104±5(before); cAMP after 30 minutes:Control=16.3±3.6pmol/ml, Formaldehyde right eye=88.5±35pmol/ml, Formaldehyde left | Tissue SampleAlbino rabbits of both sexes weighing 2.2-3.1 kg were used. Right eye=Contralateral eye and left eye=Experimental. | PUBMED ID2842178 |
| ID1444 | SequenceYGGFL | NameLeucine enkephalin | Nature of peptide or cargoLeu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | AssayRadioactive determination | Tissue permeabilityFluid: Tears- intact peptide=800pmoles/ml fluid, degraded peptide=2250pmoles/ml fluid, Percent of recovered enkephalin attributable to degradation products=33.7% | Tissue SampleSuperior limbus of both eyes of each male, albino New Zealand rabbits | PUBMED ID3503119 |
| ID1445 | SequenceYGGFL | NameLeucine enkephalin | Nature of peptide or cargoLeu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | AssayRadioactive determination | Tissue permeabilityFluid: Tears- intact peptide=250pmoles/ml fluid, degraded peptide=500pmoles/ml fluid, Percent of recovered enkephalin attributable to degradation products=59% | Tissue SampleSuperior limbus of both eyes of each male, albino New Zealand rabbits | PUBMED ID3503119 |
| ID1446 | SequenceYGGFL | NameLeucine enkephalin | Nature of peptide or cargoLeu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | AssayRadioactive determination | Tissue permeabilityTissue: Conjunctiva- intact peptide=135pmoles/g tissue, degraded peptide=172pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=76.7% | Tissue SampleSuperior limbus of both eyes of each male, albino New Zealand rabbits | PUBMED ID3503119 |
| ID1447 | SequenceYGGFL | NameLeucine enkephalin | Nature of peptide or cargoLeu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | AssayRadioactive determination | Tissue permeabilityTissue: Conjunctiva- intact peptide=175pmoles/g tissue, degraded peptide=185pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=85% | Tissue SampleSuperior limbus of both eyes of each male, albino New Zealand rabbits | PUBMED ID3503119 |
| ID1448 | SequenceYGGFL | NameLeucine enkephalin | Nature of peptide or cargoLeu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | AssayRadioactive determination | Tissue permeabilityTissue: Conjunctiva- intact peptide=180pmoles/g tissue, degraded peptide=230pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=81.7% | Tissue SampleSuperior limbus of both eyes of each male, albino New Zealand rabbits | PUBMED ID3503119 |
| ID1449 | SequenceYGGFL | NameLeucine enkephalin | Nature of peptide or cargoLeu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | AssayRadioactive determination | Tissue permeabilityTissue: Corneal epithelium- intact peptide=270pmoles/g tissue, degraded peptide=300pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=86.1% | Tissue SampleSuperior limbus of both eyes of each male, albino New Zealand rabbits | PUBMED ID3503119 |
| ID1450 | SequenceYGGFL | NameLeucine enkephalin | Nature of peptide or cargoLeu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | AssayRadioactive determination | Tissue permeabilityTissue: Corneal epithelium- intact peptide=655pmoles/g tissue, degraded peptide=710pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=91.6% | Tissue SampleSuperior limbus of both eyes of each male, albino New Zealand rabbits | PUBMED ID3503119 |
| ID1451 | SequenceYGGFL | NameLeucine enkephalin | Nature of peptide or cargoLeu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | AssayRadioactive determination | Tissue permeabilityTissue: Corneal epithelium- intact peptide=885pmoles/g tissue, degraded peptide=1120pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=72.1% | Tissue SampleSuperior limbus of both eyes of each male, albino New Zealand rabbits | PUBMED ID3503119 |
| ID1452 | SequenceYGGFL | NameLeucine enkephalin | Nature of peptide or cargoLeu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | AssayRadioactive determination | Tissue permeabilityTissue: Corneal stroma- intact peptide=28pmoles/g tissue, degraded peptide=31pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=87.9% | Tissue SampleSuperior limbus of both eyes of each male, albino New Zealand rabbits | PUBMED ID3503119 |
| ID1453 | SequenceYGGFL | NameLeucine enkephalin | Nature of peptide or cargoLeu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | AssayRadioactive determination | Tissue permeabilityTissue: Corneal stroma- intact peptide=81pmoles/g tissue, degraded peptide=92pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=84.2% | Tissue SampleSuperior limbus of both eyes of each male, albino New Zealand rabbits | PUBMED ID3503119 |
| ID1454 | SequenceYGGFL | NameLeucine enkephalin | Nature of peptide or cargoLeu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | AssayRadioactive determination | Tissue permeabilityTissue: Corneal stroma- intact peptide=37.5pmoles/g tissue, degraded peptide=48pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=96.6% | Tissue SampleSuperior limbus of both eyes of each male, albino New Zealand rabbits | PUBMED ID3503119 |
| ID1455 | SequenceYGGFL | NameLeucine enkephalin | Nature of peptide or cargoLeu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | AssayRadioactive determination | Tissue permeabilityTissue: Iris-Ciliary Body- intact peptide=5.2pmoles/g tissue, degraded peptide=6.5pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=81.0% | Tissue SampleSuperior limbus of both eyes of each male, albino New Zealand rabbits | PUBMED ID3503119 |
| ID1456 | SequenceYGGFL | NameLeucine enkephalin | Nature of peptide or cargoLeu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | AssayRadioactive determination | Tissue permeabilityTissue: Iris-Ciliary Body- intact peptide=8.3pmoles/g tissue, degraded peptide=9pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=98.1% | Tissue SampleSuperior limbus of both eyes of each male, albino New Zealand rabbits | PUBMED ID3503119 |
| ID1457 | SequenceYGGFL | NameLeucine enkephalin | Nature of peptide or cargoLeu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | AssayRadioactive determination | Tissue permeabilityTissue: Iris-Ciliary Body- intact peptide=4.8pmoles/g tissue, degraded peptide=5.5pmoles/g tissue, Percent of recovered enkephalin attributable to degradation products=96.8% | Tissue SampleSuperior limbus of both eyes of each male, albino New Zealand rabbits | PUBMED ID3503119 |
| ID1458 | SequenceYGGFL | NameLeucine enkephalin | Nature of peptide or cargoLeu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | AssayRadioactive determination | Tissue permeabilityFluid: Aqueous humor- intact peptide=0.75pmoles/ml fluid, degraded peptide=0.9pmoles/ml fluid, Percent of recovered enkephalin attributable to degradation products=93.8% | Tissue SampleSuperior limbus of both eyes of each male, albino New Zealand rabbits | PUBMED ID3503119 |
| ID1459 | SequenceYGGFL | NameLeucine enkephalin | Nature of peptide or cargoLeu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | AssayRadioactive determination | Tissue permeabilityFluid: Aqueous humor- intact peptide=5.4pmoles/ml fluid, degraded peptide=5.7pmoles/ml fluid, Percent of recovered enkephalin attributable to degradation products=99.0% | Tissue SampleSuperior limbus of both eyes of each male, albino New Zealand rabbits | PUBMED ID3503119 |
| ID1460 | SequenceYGGFL | NameLeucine enkephalin | Nature of peptide or cargoLeu-enkephalin is an endogenous opioid peptide neurotransmitter that is found naturally in the brains of many animals, including humans. | AssayRadioactive determination | Tissue permeabilityFluid: Aqueous humor- intact peptide=5.0pmoles/ml fluid, degraded peptide=5.24pmoles/ml fluid, Percent of recovered enkephalin attributable to degradation products=99.4% | Tissue SampleSuperior limbus of both eyes of each male, albino New Zealand rabbits | PUBMED ID3503119 |