Browse result page of PRRDB 2.0
| PRRID | Name of Ligand | Source of ligand | Sequence of Ligand | Length of Ligand | Type of Ligand | Occurence | Role of Ligand | Name of Receptor | Type of Reeptor | Source of the Receptor | Localization | Domain | Sequence of Receptor | Swiss prot ID | Length of receptor | Function of Receptor | Assay used | PMID | Year of publication | Pubchem assay |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PRRID_0005 | Fucoidan Click for more detail | NA | CC1C(C(C(C(O1)C)OS(=O)(=O)O)O)O | NA | Carbohydrate | Natural | elicit innate immune response | Scavenger receptor A I (SR-A I) | Scavenger receptor (SR) | Bovine | smooth muscle cells | NA | NA | NA | NA | NA | NA | 3397384 | 1988 | NA |
| PRRID_0005 | Fucoidan Click for more detail | NA | CC1C(C(C(C(O1)C)OS(=O)(=O)O)O)O | NA | Carbohydrate | Natural | elicit innate immune response | Scavenger receptor A I (SR-A I) | Scavenger receptor (SR) | Bovine | smooth muscle cells | NA | NA | NA | NA | NA | NA | 3397384 | 1988 | NA |
| PRRID_0011 | D-mannose Click for more detail | Bacteria | C(C1C(C(C(C(O1)O)O)O)O)O | NA | Carbohydrate | Natural | elicit innate immune response | Mannose receptor | Mannose receptor (MR) | Human | NA | NA | P22897.fasta | P22897 | 1456 | Induces pro-inflammatory cytokine response | NA | 1906888 | 1991 | Pubchem Assay |
| PRRID_0011 | D-mannose Click for more detail | Bacteria | C(C1C(C(C(C(O1)O)O)O)O)O | NA | Carbohydrate | Natural | elicit innate immune response | Mannose receptor | Mannose receptor (MR) | Human | NA | NA | P22897.fasta | P22897 | 1456 | Induces pro-inflammatory cytokine response | NA | 1906888 | 1991 | Pubchem Assay |
| PRRID_0012 | Fucoidan Click for more detail | NA | CC1C(C(C(C(O1)C)OS(=O)(=O)O)O)O | NA | Carbohydrate | Natural | It Stimulates the secretion of urokinasetype plasminogen activator (uPA) in Protein Kinase-C (PKC) dependent manner. | Scavenger receptor class A | Scavenger receptor (SR) | Macrophage cell line (RAW264) | Macrophages | NA | NA | NA | NA | It leads to polyanion-induced macrophage plasminogen activation. | Functional assay for plasmin | 1658006 | 1991 | NA |
| PRRID_0012 | Fucoidan Click for more detail | NA | CC1C(C(C(C(O1)C)OS(=O)(=O)O)O)O | NA | Carbohydrate | Natural | It Stimulates the secretion of urokinasetype plasminogen activator (uPA) in Protein Kinase-C (PKC) dependent manner. | Scavenger receptor class A | Scavenger receptor (SR) | Macrophage cell line (RAW264) | Macrophages | NA | NA | NA | NA | It leads to polyanion-induced macrophage plasminogen activation. | Functional assay for plasmin | 1658006 | 1991 | NA |
| PRRID_0013 | L-fucose Click for more detail | Bacteria | CC(C(C(C(C=O)O)O)O)O | NA | Carbohydrate | Natural | elicit innate immune response | Mannose receptor | Mannose receptor (MR) | Human | NA | NA | P22897.fasta | P22897 | 1456 | Induces pro-inflammatory cytokine response | NA | 1906888 | 1991 | Pubchem Assay |
| PRRID_0013 | L-fucose Click for more detail | Bacteria | CC(C(C(C(C=O)O)O)O)O | NA | Carbohydrate | Natural | elicit innate immune response | Mannose receptor | Mannose receptor (MR) | Human | NA | NA | P22897.fasta | P22897 | 1456 | Induces pro-inflammatory cytokine response | NA | 1906888 | 1991 | Pubchem Assay |
| PRRID_0014 | N-acetylmannosamine Click for more detail | Bacteria | CC(=O)NC1C(C(C(OC1O)CO)O)O | NA | Carbohydrate | Natural | elicit innate immune response | Mannose receptor | Mannose receptor (MR) | Human | NA | NA | P22897.fasta | P22897 | 1456 | Induces pro-inflammatory cytokine response | NA | 1906888 | 1991 | Pubchem Assay |
| PRRID_0014 | N-acetylmannosamine Click for more detail | Bacteria | CC(=O)NC1C(C(C(OC1O)CO)O)O | NA | Carbohydrate | Natural | elicit innate immune response | Mannose receptor | Mannose receptor (MR) | Human | NA | NA | P22897.fasta | P22897 | 1456 | Induces pro-inflammatory cytokine response | NA | 1906888 | 1991 | Pubchem Assay |
| PRRID_0016 | Phorbol myristate acetate (PMA) Click for more detail | NA | CCCCCCCCCCCCCC(=O)OC1C(C2(C(C=C(CC3(C2C=C(C3=O)C)O)CO)C4C1(C4(C)C)OC(=O)C)O)C | NA | Carbohydrate | Natural | It Stimulates the secretion of urokinasetype plasminogen activator (uPA) in Protein Kinase-C (PKC) dependent manner. | Scavenger receptor class A | Scavenger receptor (SR) | Macrophage cell line (RAW264) | Macrophages | NA | NA | NA | NA | It leads to polyanion-induced macrophage plasminogen activation. | Functional assay for plasmin | 1658006 | 1991 | NA |
| PRRID_0016 | Phorbol myristate acetate (PMA) Click for more detail | NA | CCCCCCCCCCCCCC(=O)OC1C(C2(C(C=C(CC3(C2C=C(C3=O)C)O)CO)C4C1(C4(C)C)OC(=O)C)O)C | NA | Carbohydrate | Natural | It Stimulates the secretion of urokinasetype plasminogen activator (uPA) in Protein Kinase-C (PKC) dependent manner. | Scavenger receptor class A | Scavenger receptor (SR) | Macrophage cell line (RAW264) | Macrophages | NA | NA | NA | NA | It leads to polyanion-induced macrophage plasminogen activation. | Functional assay for plasmin | 1658006 | 1991 | NA |
| PRRID_0038 | Laminarin Click for more detail | laminaria (others) | C(C1C(C(C(C(O1)O)O)OC2C(C(C(C(O2)CO)O)OC3C(C(C(C(O3)CO)O)O)O)O)O)O | NA | Carbohydrate | Natural | Immunostimulant | Scavenger receptor C-1 (SR-C1) | Scavenger receptor (SR) | Drosophila melanogaster | NA | two complement control protein (CCP) domains and somatomedin B, MAM, and mucin-like domains | NA | NA | NA | NA | NA | 7732030 | 1995 | NA |
| PRRID_0038 | Laminarin Click for more detail | laminaria (others) | C(C1C(C(C(C(O1)O)O)OC2C(C(C(C(O2)CO)O)OC3C(C(C(C(O3)CO)O)O)O)O)O)O | NA | Carbohydrate | Natural | Immunostimulant | Scavenger receptor C-1 (SR-C1) | Scavenger receptor (SR) | Drosophila melanogaster | NA | two complement control protein (CCP) domains and somatomedin B, MAM, and mucin-like domains | NA | NA | NA | NA | NA | 7732030 | 1995 | NA |
| PRRID_0079 | Chondroitin Sulfates A Click for more detail | Host (Endogenous) (others) | CC(=O)NC1C(C(C(OC1O)CO)OS(=O)(=O)O)OC2C(C(C(C(O2)C(=O)O)O)O)O | NA | Carbohydrate | Natural | Chondroitin Sulfates A binds to mannose receptor via a membrane-distal cysteine-rich domain (Cys-MR). | Cys-MR | Mannose receptor (MR) | Human | Spleenocytes | carbohydrate-recognition domain (CRD) | NA | NA | NA | The Cysteine-rich Domain of the Macrophage Mannose Receptor Is a Multispecific Lectin That Recognizes Chondroitin Sulfates A and B and Sulfated Oligosaccharides of Blood Group. | NA | 10748230 | 2000 | NA |
| PRRID_0079 | Chondroitin Sulfates A Click for more detail | Host (Endogenous) (others) | CC(=O)NC1C(C(C(OC1O)CO)OS(=O)(=O)O)OC2C(C(C(C(O2)C(=O)O)O)O)O | NA | Carbohydrate | Natural | Chondroitin Sulfates A binds to mannose receptor via a membrane-distal cysteine-rich domain (Cys-MR). | Cys-MR | Mannose receptor (MR) | Human | Spleenocytes | carbohydrate-recognition domain (CRD) | NA | NA | NA | The Cysteine-rich Domain of the Macrophage Mannose Receptor Is a Multispecific Lectin That Recognizes Chondroitin Sulfates A and B and Sulfated Oligosaccharides of Blood Group. | NA | 10748230 | 2000 | NA |
| PRRID_0080 | Chondroitin Sulfates B Click for more detail | Host (Endogenous) (others) | NA | NA | Carbohydrate | Natural | Chondroitin Sulfates A binds to mannose receptor via a membrane-distal cysteine-rich domain (Cys-MR). | Cys-MR | Mannose receptor (MR) | Human | Spleenocytes | carbohydrate-recognition domain (CRD) | NA | NA | NA | The Cysteine-rich Domain of the Macrophage Mannose Receptor Is a Multispecific Lectin That Recognizes Chondroitin Sulfates A and B and Sulfated Oligosaccharides of Blood Group. | NA | 10748230 | 2000 | NA |
| PRRID_0080 | Chondroitin Sulfates B Click for more detail | Host (Endogenous) (others) | NA | NA | Carbohydrate | Natural | Chondroitin Sulfates A binds to mannose receptor via a membrane-distal cysteine-rich domain (Cys-MR). | Cys-MR | Mannose receptor (MR) | Human | Spleenocytes | carbohydrate-recognition domain (CRD) | NA | NA | NA | The Cysteine-rich Domain of the Macrophage Mannose Receptor Is a Multispecific Lectin That Recognizes Chondroitin Sulfates A and B and Sulfated Oligosaccharides of Blood Group. | NA | 10748230 | 2000 | NA |
| PRRID_0095 | Sulfated blood group chains Click for more detail | Host (Endogenous) (others) | NA | NA | Carbohydrate | Natural | Chondroitin Sulfates A binds to mannose receptor via a membrane-distal cysteine-rich domain (Cys-MR). | Cys-MR | Mannose receptor (MR) | Human | Spleenocytes | carbohydrate-recognition domain (CRD) | NA | NA | NA | The Cysteine-rich Domain of the Macrophage Mannose Receptor Is a Multispecific Lectin That Recognizes Chondroitin Sulfates A and B and Sulfated Oligosaccharides of Blood Group. | NA | 10748230 | 2000 | NA |
| PRRID_0095 | Sulfated blood group chains Click for more detail | Host (Endogenous) (others) | NA | NA | Carbohydrate | Natural | Chondroitin Sulfates A binds to mannose receptor via a membrane-distal cysteine-rich domain (Cys-MR). | Cys-MR | Mannose receptor (MR) | Human | Spleenocytes | carbohydrate-recognition domain (CRD) | NA | NA | NA | The Cysteine-rich Domain of the Macrophage Mannose Receptor Is a Multispecific Lectin That Recognizes Chondroitin Sulfates A and B and Sulfated Oligosaccharides of Blood Group. | NA | 10748230 | 2000 | NA |
| PRRID_0114 | alpha-methylmannoside Click for more detail | Bacteria | COC1C(C(C(C(O1)CO)O)O)O | NA | Carbohydrate | Natural | Immunostimulant | Endo180 | Mannose receptor (MR) | Human | NA | lectin-like domains | Q9UBG0.fasta | Q9UBG0 | 1479 | NA | Sugar-Binding assay | 12399458 | 2002 | Pubchem Assay |
| PRRID_0114 | alpha-methylmannoside Click for more detail | Bacteria | COC1C(C(C(C(O1)CO)O)O)O | NA | Carbohydrate | Natural | Immunostimulant | Endo180 | Mannose receptor (MR) | Human | NA | lectin-like domains | Q9UBG0.fasta | Q9UBG0 | 1479 | NA | Sugar-Binding assay | 12399458 | 2002 | Pubchem Assay |
| PRRID_0117 | Fucose Click for more detail | Bacteria | CC(C(C(C(C=O)O)O)O)O | NA | Carbohydrate | Natural | Immunostimulant | Endo180 | Mannose receptor (MR) | Human | NA | lectin-like domains | Q9UBG0.fasta | Q9UBG0 | 1479 | NA | Sugar-Binding assay | 12399458 | 2002 | Pubchem Assay |
| PRRID_0117 | Fucose Click for more detail | Bacteria | CC(C(C(C(C=O)O)O)O)O | NA | Carbohydrate | Natural | Immunostimulant | Endo180 | Mannose receptor (MR) | Human | NA | lectin-like domains | Q9UBG0.fasta | Q9UBG0 | 1479 | NA | Sugar-Binding assay | 12399458 | 2002 | Pubchem Assay |
| PRRID_0118 | glucose Click for more detail | Bacteria | C(C1C(C(C(C(O1)O)O)O)O)O | NA | Carbohydrate | Natural | Immunostimulant | Endo180 | Mannose receptor (MR) | Human | NA | lectin-like domains | Q9UBG0.fasta | Q9UBG0 | 1479 | NA | Sugar-Binding assay | 12399458 | 2002 | Pubchem Assay |
| PRRID_0118 | glucose Click for more detail | Bacteria | C(C1C(C(C(C(O1)O)O)O)O)O | NA | Carbohydrate | Natural | Immunostimulant | Endo180 | Mannose receptor (MR) | Human | NA | lectin-like domains | Q9UBG0.fasta | Q9UBG0 | 1479 | NA | Sugar-Binding assay | 12399458 | 2002 | Pubchem Assay |
| PRRID_0131 | Hyaluronic acid Click for more detail | Host (Endogenous) (others) | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Carbohydrate | Natural | potent activators of immunocompetent cells such as dendritic cells (DCs) and macrophages | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Bone Marrow–derived DCs | transmembrane domain that associates with the intra- cellular adaptor protein MyD88 | Q9QUK6.fasta | Q9QUK6 | 835 | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system | ELISA | 11781369 | 2002 | Pubchem Assay |
| PRRID_0131 | Hyaluronic acid Click for more detail | Host (Endogenous) (others) | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Carbohydrate | Natural | potent activators of immunocompetent cells such as dendritic cells (DCs) and macrophages | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Bone Marrow–derived DCs | transmembrane domain that associates with the intra- cellular adaptor protein MyD88 | Q9QUK6.fasta | Q9QUK6 | 835 | TLR 4 leads to an intracellular signaling pathway NF-κB and inflammatory cytokine production which is responsible for activating the innate immune system | ELISA | 11781369 | 2002 | Pubchem Assay |
| PRRID_0138 | Mannose Click for more detail | Fungi | C(C1C(C(C(C(O1)O)O)O)O)O | NA | Carbohydrate | Natural | Immunostimulant | Endo180 | Mannose receptor (MR) | Human | NA | lectin-like domains | Q9UBG0.fasta | Q9UBG0 | 1479 | NA | Sugar-Binding assay | 12399458 | 2002 | Pubchem Assay |
| PRRID_0138 | Mannose Click for more detail | Fungi | C(C1C(C(C(C(O1)O)O)O)O)O | NA | Carbohydrate | Natural | Immunostimulant | Endo180 | Mannose receptor (MR) | Human | NA | lectin-like domains | Q9UBG0.fasta | Q9UBG0 | 1479 | NA | Sugar-Binding assay | 12399458 | 2002 | Pubchem Assay |
| PRRID_0140 | N-acetylmannosamine Click for more detail | Bacteria | CC(=O)NC1C(C(C(OC1O)CO)O)O | NA | Carbohydrate | Natural | Immunostimulant | Endo180 | Mannose receptor (MR) | Human | NA | lectin-like domains | Q9UBG0.fasta | Q9UBG0 | 1479 | NA | Sugar-Binding assay | 12399458 | 2002 | Pubchem Assay |
| PRRID_0140 | N-acetylmannosamine Click for more detail | Bacteria | CC(=O)NC1C(C(C(OC1O)CO)O)O | NA | Carbohydrate | Natural | Immunostimulant | Endo180 | Mannose receptor (MR) | Human | NA | lectin-like domains | Q9UBG0.fasta | Q9UBG0 | 1479 | NA | Sugar-Binding assay | 12399458 | 2002 | Pubchem Assay |
| PRRID_0141 | N-acetylmannosamine Click for more detail | Bacteria | CC(=O)NC1C(C(C(OC1O)CO)O)O | NA | Carbohydrate | Natural | Immunostimulant | Endo180 | Mannose receptor (MR) | Human | NA | lectin-like domains | Q9UBG0.fasta | Q9UBG0 | 1479 | NA | Sugar-Binding assay | 12399458 | 2002 | Pubchem Assay |
| PRRID_0141 | N-acetylmannosamine Click for more detail | Bacteria | CC(=O)NC1C(C(C(OC1O)CO)O)O | NA | Carbohydrate | Natural | Immunostimulant | Endo180 | Mannose receptor (MR) | Human | NA | lectin-like domains | Q9UBG0.fasta | Q9UBG0 | 1479 | NA | Sugar-Binding assay | 12399458 | 2002 | Pubchem Assay |
| PRRID_0166 | GlcNAc-MurNAc dipeptide (GM-Di) Click for more detail | Gram-negative bacteria | NA | NA | Carbohydrate | Natural | elicit innate immune response | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Human | HEK293T (human embryonic kidney 293T cells) | NA | Q9HC29.fasta | Q9HC29 | 1040 | play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response. | NA | 12871942 | 2003 | Pubchem Assay |
| PRRID_0166 | GlcNAc-MurNAc dipeptide (GM-Di) Click for more detail | Gram-negative bacteria | NA | NA | Carbohydrate | Natural | elicit innate immune response | Nucleotide Binding Oligomerization Domain Containing 2 (Nod2) | NOD-like receptor (NLR) | Human | HEK293T (human embryonic kidney 293T cells) | NA | Q9HC29.fasta | Q9HC29 | 1040 | play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response. | NA | 12871942 | 2003 | Pubchem Assay |
| PRRID_0167 | GlcNAc-MurNAc tripeptide muropeptide (GM-TriDAP) Click for more detail | Gram-negative bacteria | NA | NA | Carbohydrate | Natural | elicit innate immune response | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | HEK293T (human embryonic kidney 293T cells) | NA | Q9Y239.fasta | Q9Y239 | 953 | play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response. | NA | 12871942 | 2003 | Pubchem Assay |
| PRRID_0167 | GlcNAc-MurNAc tripeptide muropeptide (GM-TriDAP) Click for more detail | Gram-negative bacteria | NA | NA | Carbohydrate | Natural | elicit innate immune response | Nucleotide Binding Oligomerization Domain Containing 1 (Nod1) | NOD-like receptor (NLR) | Human | HEK293T (human embryonic kidney 293T cells) | NA | Q9Y239.fasta | Q9Y239 | 953 | play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response. | NA | 12871942 | 2003 | Pubchem Assay |
| PRRID_0174 | Lewis x Click for more detail | H. pylori (Bacteria) | CC1C(C(C(C(O1)OC2C(C(OC(C2OC3C(C(C(C(O3)CO)O)O)O)CO)O)NC(=O)C)O)O)O | NA | Carbohydrate | Synthetic | It strongly binds to the DC-SIGN. | DC-SIGN | C type Lectin (CTL/CLR) | K562 cells | Dendritic cells | Lectin domain | NA | NA | NA | It induces the pathogen-driven inflammatory responses. | ELISA | 12574325 | 2003 | NA |
| PRRID_0174 | Lewis x Click for more detail | H. pylori (Bacteria) | CC1C(C(C(C(O1)OC2C(C(OC(C2OC3C(C(C(C(O3)CO)O)O)O)CO)O)NC(=O)C)O)O)O | NA | Carbohydrate | Synthetic | It strongly binds to the DC-SIGN. | DC-SIGN | C type Lectin (CTL/CLR) | K562 cells | Dendritic cells | Lectin domain | NA | NA | NA | It induces the pathogen-driven inflammatory responses. | ELISA | 12574325 | 2003 | NA |
| PRRID_0175 | Lewis x Click for more detail | S. mansoni (others) | CC1C(C(C(C(O1)OC2C(C(OC(C2OC3C(C(C(C(O3)CO)O)O)O)CO)O)NC(=O)C)O)O)O | NA | Carbohydrate | Synthetic | It strongly binds to the DC-SIGN. | DC-SIGN | C type Lectin (CTL/CLR) | K562 cells | Dendritic cells | Lectin domain | NA | NA | NA | It induces the pathogen-driven inflammatory responses. | ELISA | 12574325 | 2003 | NA |
| PRRID_0175 | Lewis x Click for more detail | S. mansoni (others) | CC1C(C(C(C(O1)OC2C(C(OC(C2OC3C(C(C(C(O3)CO)O)O)O)CO)O)NC(=O)C)O)O)O | NA | Carbohydrate | Synthetic | It strongly binds to the DC-SIGN. | DC-SIGN | C type Lectin (CTL/CLR) | K562 cells | Dendritic cells | Lectin domain | NA | NA | NA | It induces the pathogen-driven inflammatory responses. | ELISA | 12574325 | 2003 | NA |
| PRRID_0179 | Mannose capped lipoarabinomannan Click for more detail | Mycobacterium tuberculosis (Bacteria) | C(C1C(C(C(C(O1)O)O)O)O)O | NA | Carbohydrate | Synthetic | It strongly binds to the DC-SIGN. | DC-SIGN | C type Lectin (CTL/CLR) | K562 cells | Dendritic cells | Lectin domain | NA | NA | NA | It induces the pathogen-driven inflammatory responses. | ELISA | 12574325 | 2003 | NA |
| PRRID_0179 | Mannose capped lipoarabinomannan Click for more detail | Mycobacterium tuberculosis (Bacteria) | C(C1C(C(C(C(O1)O)O)O)O)O | NA | Carbohydrate | Synthetic | It strongly binds to the DC-SIGN. | DC-SIGN | C type Lectin (CTL/CLR) | K562 cells | Dendritic cells | Lectin domain | NA | NA | NA | It induces the pathogen-driven inflammatory responses. | ELISA | 12574325 | 2003 | NA |
| PRRID_0182 | PIM2 Click for more detail | Mtb H37Rv (Bacteria) | NA | NA | Carbohydrate | Natural | It stimulates the stimulate TNF-alpha, which leads to IL-12 p40 secretion. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | Primary Macrophages | NA | Q9QUN7.fasta | Q9QUN7 | 784 | It leads to the inflammatory response. | ELISA | 12775723 | 2003 | Pubchem Assay |
| PRRID_0182 | PIM2 Click for more detail | Mtb H37Rv (Bacteria) | NA | NA | Carbohydrate | Natural | It stimulates the stimulate TNF-alpha, which leads to IL-12 p40 secretion. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | Primary Macrophages | NA | Q9QUN7.fasta | Q9QUN7 | 784 | It leads to the inflammatory response. | ELISA | 12775723 | 2003 | Pubchem Assay |
| PRRID_0183 | PIM2 Click for more detail | Mtb H37Rv (Bacteria) | NA | NA | Carbohydrate | Natural | It stimulates the stimulate TNF-alpha, which leads to IL-12 p40 secretion. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | Primary Macrophages | NA | Q9QUN7.fasta | Q9QUN7 | 784 | It leads to the inflammatory response. | ELISA | 12775723 | 2003 | Pubchem Assay |
| PRRID_0183 | PIM2 Click for more detail | Mtb H37Rv (Bacteria) | NA | NA | Carbohydrate | Natural | It stimulates the stimulate TNF-alpha, which leads to IL-12 p40 secretion. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | Primary Macrophages | NA | Q9QUN7.fasta | Q9QUN7 | 784 | It leads to the inflammatory response. | ELISA | 12775723 | 2003 | Pubchem Assay |
| PRRID_0184 | PIM6 Click for more detail | Mycobacterium bovis Bacillus Calmette Guerin (Bacteria) | NA | NA | Carbohydrate | Natural | It stimulates the stimulate TNF-alpha, which leads to IL-12 p40 secretion. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | Primary Macrophages | NA | Q9QUN7.fasta | Q9QUN7 | 784 | It leads to the inflammatory response. | ELISA | 12775723 | 2003 | Pubchem Assay |
| PRRID_0184 | PIM6 Click for more detail | Mycobacterium bovis Bacillus Calmette Guerin (Bacteria) | NA | NA | Carbohydrate | Natural | It stimulates the stimulate TNF-alpha, which leads to IL-12 p40 secretion. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | Primary Macrophages | NA | Q9QUN7.fasta | Q9QUN7 | 784 | It leads to the inflammatory response. | ELISA | 12775723 | 2003 | Pubchem Assay |
| PRRID_0185 | PIM6 Click for more detail | Mtb H37Rv (Bacteria) | NA | NA | Carbohydrate | Natural | It stimulates the stimulate TNF-alpha, which leads to IL-12 p40 secretion. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | Primary Macrophages | NA | Q9QUN7.fasta | Q9QUN7 | 784 | It leads to the inflammatory response. | ELISA | 12775723 | 2003 | Pubchem Assay |
| PRRID_0185 | PIM6 Click for more detail | Mtb H37Rv (Bacteria) | NA | NA | Carbohydrate | Natural | It stimulates the stimulate TNF-alpha, which leads to IL-12 p40 secretion. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | Primary Macrophages | NA | Q9QUN7.fasta | Q9QUN7 | 784 | It leads to the inflammatory response. | ELISA | 12775723 | 2003 | Pubchem Assay |
| PRRID_0189 | (man)3-ara Click for more detail | Mycobacteria (Bacteria) | NA | NA | Carbohydrate | Natural | elicit innate immune response | DC-SIGN | C type Lectin (CTL/CLR) | THP-1 and K562 | NA | NA | NA | NA | NA | It inhibits the immuno-stimulatory function of dendritic cells. | ELISA | 15481146 | 2004 | NA |
| PRRID_0189 | (man)3-ara Click for more detail | Mycobacteria (Bacteria) | NA | NA | Carbohydrate | Natural | elicit innate immune response | DC-SIGN | C type Lectin (CTL/CLR) | THP-1 and K562 | NA | NA | NA | NA | NA | It inhibits the immuno-stimulatory function of dendritic cells. | ELISA | 15481146 | 2004 | NA |
| PRRID_0190 | (man)3-ara Click for more detail | Mycobacteria (Bacteria) | NA | NA | Carbohydrate | Natural | elicit innate immune response | DC-SIGNR | C type Lectin (CTL/CLR) | THP-1 and K562 | NA | NA | NA | NA | NA | It inhibits the immuno-stimulatory function of dendritic cells. | ELISA | 15481146 | 2004 | NA |
| PRRID_0190 | (man)3-ara Click for more detail | Mycobacteria (Bacteria) | NA | NA | Carbohydrate | Natural | elicit innate immune response | DC-SIGNR | C type Lectin (CTL/CLR) | THP-1 and K562 | NA | NA | NA | NA | NA | It inhibits the immuno-stimulatory function of dendritic cells. | ELISA | 15481146 | 2004 | NA |
| PRRID_0191 | (man)3-ara Click for more detail | Mycobacteria (Bacteria) | NA | NA | Carbohydrate | Natural | elicit innate immune response | mSIGN-R1 | C type Lectin (CTL/CLR) | THP-1 and K562 | NA | NA | NA | NA | NA | It inhibits the immuno-stimulatory function of dendritic cells. | ELISA | 15481146 | 2004 | NA |
| PRRID_0191 | (man)3-ara Click for more detail | Mycobacteria (Bacteria) | NA | NA | Carbohydrate | Natural | elicit innate immune response | mSIGN-R1 | C type Lectin (CTL/CLR) | THP-1 and K562 | NA | NA | NA | NA | NA | It inhibits the immuno-stimulatory function of dendritic cells. | ELISA | 15481146 | 2004 | NA |
| PRRID_0198 | glucuronoxylomannan Click for more detail | Cryptococcus neoformans(fungi) | NA | NA | Carbohydrate | Natural | It leads to the induction of tumor necrosis factor alpha, interleukin-4, IL-10, IL-12p70 and gamma interferon. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Lung | NA | Q9QUK6.fasta | Q9QUK6 | 835 | It leads to the inflammatory response against the fungi Cryptococcus neoformans. | ELISA | 15322035 | 2004 | Pubchem Assay |
| PRRID_0198 | glucuronoxylomannan Click for more detail | Cryptococcus neoformans(fungi) | NA | NA | Carbohydrate | Natural | It leads to the induction of tumor necrosis factor alpha, interleukin-4, IL-10, IL-12p70 and gamma interferon. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | Lung | NA | Q9QUK6.fasta | Q9QUK6 | 835 | It leads to the inflammatory response against the fungi Cryptococcus neoformans. | ELISA | 15322035 | 2004 | Pubchem Assay |
| PRRID_0199 | glucuronoxylomannan Click for more detail | Cryptococcus neoformans(fungi) | NA | NA | Carbohydrate | Natural | It leads to the induction of tumor necrosis factor alpha, interleukin-4, IL-10, IL-12p70 and gamma interferon. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Lung | NA | Q9QUN7.fasta | Q9QUN7 | 784 | It leads to the inflammatory response against the fungi Cryptococcus neoformans. | ELISA | 15322035 | 2004 | Pubchem Assay |
| PRRID_0199 | glucuronoxylomannan Click for more detail | Cryptococcus neoformans(fungi) | NA | NA | Carbohydrate | Natural | It leads to the induction of tumor necrosis factor alpha, interleukin-4, IL-10, IL-12p70 and gamma interferon. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Lung | NA | Q9QUN7.fasta | Q9QUN7 | 784 | It leads to the inflammatory response against the fungi Cryptococcus neoformans. | ELISA | 15322035 | 2004 | Pubchem Assay |
| PRRID_0218 | Biglycan Click for more detail | Endogenous (others) | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYVRSWEEPAGLQQRAGVRALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLT | 238 | Carbohydrate | Natural | Immunostimulant | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Macrophages | NA | O00206.fasta | O00206 | 839 | synthesis of TNF-alpha and MIP-2. | Western blotting and ELISA. | 16025156 | 2005 | Pubchem Assay |
| PRRID_0218 | Biglycan Click for more detail | Endogenous (others) | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYVRSWEEPAGLQQRAGVRALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLT | 238 | Carbohydrate | Natural | Immunostimulant | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Human | Macrophages | NA | O00206.fasta | O00206 | 839 | synthesis of TNF-alpha and MIP-2. | Western blotting and ELISA. | 16025156 | 2005 | Pubchem Assay |
| PRRID_0264 | Tripalmitoylated proteins Click for more detail | NA | NA | NA | Carbohydrate | Natural | triggers immune responses | Toll-like receptor 2 (TLR2)/Toll-like receptor (TLR1 | Toll-like receptor (TLR) | Mice | Peripheral blood mononuclear cells (PBMC) | cytoplasmic leucine rich repeat (LRR) | NA | NA | NA | TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6. | ELISA | 17353199 | 2007 | NA |
| PRRID_0264 | Tripalmitoylated proteins Click for more detail | NA | NA | NA | Carbohydrate | Natural | triggers immune responses | Toll-like receptor 2 (TLR2)/Toll-like receptor (TLR1 | Toll-like receptor (TLR) | Mice | Peripheral blood mononuclear cells (PBMC) | cytoplasmic leucine rich repeat (LRR) | NA | NA | NA | TLR2 is involved in the specific recognition of a wide range of ligands, either as a homodimer or as a heterodimer with TLR1 or TLR6. | ELISA | 17353199 | 2007 | NA |
| PRRID_0273 | Carbohydrate moieties Click for more detail | Candida albicans(fungi) | NA | NA | Carbohydrate | Natural | The stimulation of mincle by carbohydrate moities, leads to the production of TNF-‚ç∫ by macrophages. | Mincle | C type Lectin (CTL/CLR) | Mice | Macropahges | Carbohydrate binding motif (EPN) | Q9R0Q8.fasta | Q9R0Q8 | 214 | Mincle plays a significant role in the mammalian immune response against the yeast. | ELISA | 18490740 | 2008 | Pubchem Assay |
| PRRID_0273 | Carbohydrate moieties Click for more detail | Candida albicans(fungi) | NA | NA | Carbohydrate | Natural | The stimulation of mincle by carbohydrate moities, leads to the production of TNF-‚ç∫ by macrophages. | Mincle | C type Lectin (CTL/CLR) | Mice | Macropahges | Carbohydrate binding motif (EPN) | Q9R0Q8.fasta | Q9R0Q8 | 214 | Mincle plays a significant role in the mammalian immune response against the yeast. | ELISA | 18490740 | 2008 | Pubchem Assay |
| PRRID_0292 | Glucan Click for more detail | eukaryotic fungi (fungi) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | Glucan binds to vitellogenin with high affinity. | Vitellogenin | Phospholipoglycoprotein | Hexagrammos otakii | Macropahes | NA | NA | NA | NA | Vg is involved in anti-infectious response, functions as an opsonin that can enhance macrophage phagocytosis. | ELISA | 18398466 | 2008 | NA |
| PRRID_0292 | Glucan Click for more detail | eukaryotic fungi (fungi) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | Glucan binds to vitellogenin with high affinity. | Vitellogenin | Phospholipoglycoprotein | Hexagrammos otakii | Macropahes | NA | NA | NA | NA | Vg is involved in anti-infectious response, functions as an opsonin that can enhance macrophage phagocytosis. | ELISA | 18398466 | 2008 | NA |
| PRRID_0300 | Laminarin Click for more detail | brown algae(others) | C(C1C(C(C(C(O1)O)O)OC2C(C(C(C(O2)CO)O)OC3C(C(C(C(O3)CO)O)O)O)O)O)O | NA | Carbohydrate | Natural | Laminarin binds to vitellogenin with high affinity. | Vitellogenin | Phospholipoglycoprotein | Hexagrammos otakii | Macropahes | NA | NA | NA | NA | Vg is involved in anti-infectious response, functions as an opsonin that can enhance macrophage phagocytosis. | ELISA | 18398466 | 2008 | NA |
| PRRID_0300 | Laminarin Click for more detail | brown algae(others) | C(C1C(C(C(C(O1)O)O)OC2C(C(C(C(O2)CO)O)OC3C(C(C(C(O3)CO)O)O)O)O)O)O | NA | Carbohydrate | Natural | Laminarin binds to vitellogenin with high affinity. | Vitellogenin | Phospholipoglycoprotein | Hexagrammos otakii | Macropahes | NA | NA | NA | NA | Vg is involved in anti-infectious response, functions as an opsonin that can enhance macrophage phagocytosis. | ELISA | 18398466 | 2008 | NA |
| PRRID_0333 | Plant polysaccharide (EP) Click for more detail | Echinacea purpurea(plant) | NA | NA | Carbohydrate | Natural | It leads to the activation of NF-κB and stimulates the production of IL-6, TNF, IL-12 and NO. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | Peritoneal macrophages | NA | Q9QUK6.fasta | Q9QUK6 | 835 | Echinacea polysaccharides have immunomodulatory activity. | ELISA | 18618312 | 2008 | Pubchem Assay |
| PRRID_0333 | Plant polysaccharide (EP) Click for more detail | Echinacea purpurea(plant) | NA | NA | Carbohydrate | Natural | It leads to the activation of NF-κB and stimulates the production of IL-6, TNF, IL-12 and NO. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | Peritoneal macrophages | NA | Q9QUK6.fasta | Q9QUK6 | 835 | Echinacea polysaccharides have immunomodulatory activity. | ELISA | 18618312 | 2008 | Pubchem Assay |
| PRRID_0361 | Carrageenan Click for more detail | Dietary Products(others) | C1C2C(C(O1)C(C(O2)O)O)OC3C(C(C(C(O3)CO)OS(=O)(=O)[O-])OC4C(C5C(C(O4)CO5)OC6C(C(C(C(O6)CO)OS(=O)(=O)[O-])O)O)O)O | NA | Carbohydrate | Synthetic | It has the its inhibitory effects on LPS-induced TLR4-mediated NF-kappaB activation. | Deleted in malignant brain tumors 1 (DMBT1) | Pattern recognition receptor (PRR) | Mice | NA | NA | Q60997.fasta | Q60997 | 2085 | Carrageenan inhibit DMBT1-mediated bacterial aggregation. | ELISA | 19189310 | 2009 | Pubchem Assay |
| PRRID_0361 | Carrageenan Click for more detail | Dietary Products(others) | C1C2C(C(O1)C(C(O2)O)O)OC3C(C(C(C(O3)CO)OS(=O)(=O)[O-])OC4C(C5C(C(O4)CO5)OC6C(C(C(C(O6)CO)OS(=O)(=O)[O-])O)O)O)O | NA | Carbohydrate | Synthetic | It has the its inhibitory effects on LPS-induced TLR4-mediated NF-kappaB activation. | Deleted in malignant brain tumors 1 (DMBT1) | Pattern recognition receptor (PRR) | Mice | NA | NA | Q60997.fasta | Q60997 | 2085 | Carrageenan inhibit DMBT1-mediated bacterial aggregation. | ELISA | 19189310 | 2009 | Pubchem Assay |
| PRRID_0366 | Dextran Sulfate Sodium (DSS) Click for more detail | Dietary Products(others) | CC1C(C(C(C(O1)OCC2C(C(C(C(O2)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)O.Na | NA | Carbohydrate | Synthetic | It has the its inhibitory effects on LPS-induced TLR4-mediated NF-kappaB activation. | Deleted in malignant brain tumors 1 (DMBT1) | Pattern recognition receptor (PRR) | Mice | NA | NA | Q60997.fasta | Q60997 | 2085 | DSS inhibit DMBT1-mediated bacterial aggregation. | ELISA | 19189310 | 2009 | Pubchem Assay |
| PRRID_0366 | Dextran Sulfate Sodium (DSS) Click for more detail | Dietary Products(others) | CC1C(C(C(C(O1)OCC2C(C(C(C(O2)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)OS(=O)(=O)O)O.Na | NA | Carbohydrate | Synthetic | It has the its inhibitory effects on LPS-induced TLR4-mediated NF-kappaB activation. | Deleted in malignant brain tumors 1 (DMBT1) | Pattern recognition receptor (PRR) | Mice | NA | NA | Q60997.fasta | Q60997 | 2085 | DSS inhibit DMBT1-mediated bacterial aggregation. | ELISA | 19189310 | 2009 | Pubchem Assay |
| PRRID_0401 | 1,3 beta glucan Click for more detail | Sparassis crispa (fungi) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | Anti-tumour properties | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | It can induce the phenotypic and functional maturation of DCs. | NA | 20699131 | 2010 | Pubchem Assay |
| PRRID_0401 | 1,3 beta glucan Click for more detail | Sparassis crispa (fungi) | C(C1C(C(C(C(O1)OC2C(OC(C(C2O)O)OC3C(OC(C(C3O)O)O)CO)CO)O)O)O)O | NA | Carbohydrate | Natural | Anti-tumour properties | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice | dendritic cells and macrophages | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | It can induce the phenotypic and functional maturation of DCs. | NA | 20699131 | 2010 | Pubchem Assay |
| PRRID_0431 | Chitin Click for more detail | Bacteria | NA | NA | Carbohydrate | Natural | It triggered the PAMP mediated immunity | CERK1 | Pattern recognition receptor (PRR) | Plants | NA | NA | A8R7E6.fasta | A8R7E6 | 617 | It provides the immunity to the plant against the pathogen by recognizing the PAMP | NA | 20713980 | 2010 | Pubchem Assay |
| PRRID_0431 | Chitin Click for more detail | Bacteria | NA | NA | Carbohydrate | Natural | It triggered the PAMP mediated immunity | CERK1 | Pattern recognition receptor (PRR) | Plants | NA | NA | A8R7E6.fasta | A8R7E6 | 617 | It provides the immunity to the plant against the pathogen by recognizing the PAMP | NA | 20713980 | 2010 | Pubchem Assay |
| PRRID_0432 | Chitin Click for more detail | Bacteria | NA | NA | Carbohydrate | Natural | It induce the MAPK activation | Heterodimer of CERK1 and CEBiP | Pattern recognition receptor (PRR) | Rice | NA | NA | NA | NA | NA | It has the role in the inflammation. | NA | 20713980 | 2010 | NA |
| PRRID_0432 | Chitin Click for more detail | Bacteria | NA | NA | Carbohydrate | Natural | It induce the MAPK activation | Heterodimer of CERK1 and CEBiP | Pattern recognition receptor (PRR) | Rice | NA | NA | NA | NA | NA | It has the role in the inflammation. | NA | 20713980 | 2010 | NA |
| PRRID_0433 | Chitin Click for more detail | Crab shell(others) | CC(=O)NC1C(C(C(OC1O)CO)O)O | NA | Carbohydrate | Natural | It induces phosphorylation of CERK1 at multiple residues in the juxtamembrane and kinase domain | lysin motif (LysM)- containing chitin elicitor receptor kinase 1 (CERK1) | Pattern recognition receptor (PRR) | Arabidopsis | NA | NA | A8R7E6.fasta | A8R7E6 | 617 | It provides resistance o fungal pathogens | NA | 20610395 | 2010 | Pubchem Assay |
| PRRID_0433 | Chitin Click for more detail | Crab shell(others) | CC(=O)NC1C(C(C(OC1O)CO)O)O | NA | Carbohydrate | Natural | It induces phosphorylation of CERK1 at multiple residues in the juxtamembrane and kinase domain | lysin motif (LysM)- containing chitin elicitor receptor kinase 1 (CERK1) | Pattern recognition receptor (PRR) | Arabidopsis | NA | NA | A8R7E6.fasta | A8R7E6 | 617 | It provides resistance o fungal pathogens | NA | 20610395 | 2010 | Pubchem Assay |
| PRRID_0461 | Dextran Click for more detail | Bacteria | C(C1C(C(C(C(O1)OCC2C(C(C(C(O2)OCC(C(C(C(C=O)O)O)O)O)O)O)O)O)O)O)O | NA | Carbohydrate | Natural | It is the responsive PAMP for the FcLec5 | FcLec5 | C type Lectin (CTL/CLR) | Fenneropenaeus chinensis | hepatopancreas | CRD | NA | NA | NA | It elicit the immune response, which leads to the clearance of bacteria | ELISA | 20349323 | 2010 | NA |
| PRRID_0461 | Dextran Click for more detail | Bacteria | C(C1C(C(C(C(O1)OCC2C(C(C(C(O2)OCC(C(C(C(C=O)O)O)O)O)O)O)O)O)O)O)O | NA | Carbohydrate | Natural | It is the responsive PAMP for the FcLec5 | FcLec5 | C type Lectin (CTL/CLR) | Fenneropenaeus chinensis | hepatopancreas | CRD | NA | NA | NA | It elicit the immune response, which leads to the clearance of bacteria | ELISA | 20349323 | 2010 | NA |
| PRRID_0569 | Hyaluronan Click for more detail | Prepared by HCL degradation (others) | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Carbohydrate | Synthetic | Its binding leads to the production of interleukin-10, and down-regulated chemokine production. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | MRL-lpr/lpr Mice | Large intestinal epithelial cells | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | It modulates Th-1-type autoimmune disease and inflammation by up-regulating SOCS3 expression and down-regulating pleiotrophin expression via TLR-4 in intestinal epithelial cells and hence promotes the survival. | Array Analysis | 20504769 | 2010 | Pubchem Assay |
| PRRID_0569 | Hyaluronan Click for more detail | Prepared by HCL degradation (others) | CC(=O)NC1CC(C(OC1OC2C(C(C(OC2C(=O)[O-])O)O)O)CO)O | NA | Carbohydrate | Synthetic | Its binding leads to the production of interleukin-10, and down-regulated chemokine production. | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | MRL-lpr/lpr Mice | Large intestinal epithelial cells | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | It modulates Th-1-type autoimmune disease and inflammation by up-regulating SOCS3 expression and down-regulating pleiotrophin expression via TLR-4 in intestinal epithelial cells and hence promotes the survival. | Array Analysis | 20504769 | 2010 | Pubchem Assay |
| PRRID_0674 | Mannose Click for more detail | NA | C(C1C(C(C(C(O1)O)O)O)O)O | NA | Carbohydrate | Natural | elicit innate immune response | Millectin | C type Lectin (CTL/CLR) | coral Acropora millepora | nematocysts in epidermal tissue | NA | NA | NA | NA | Millectin expression is up-regulated in response to lipopolysaccharide and peptidoglycan | immunohistochemistry | 20600272 | 2010 | NA |
| PRRID_0674 | Mannose Click for more detail | NA | C(C1C(C(C(C(O1)O)O)O)O)O | NA | Carbohydrate | Natural | elicit innate immune response | Millectin | C type Lectin (CTL/CLR) | coral Acropora millepora | nematocysts in epidermal tissue | NA | NA | NA | NA | Millectin expression is up-regulated in response to lipopolysaccharide and peptidoglycan | immunohistochemistry | 20600272 | 2010 | NA |
| PRRID_0675 | Mannose Click for more detail | NA | C(C1C(C(C(C(O1)O)O)O)O)O | NA | Carbohydrate | Natural | NA | Complement factor C3-like protein (C3-Am) | Pattern recognition receptor (PRR) | coral Acropora millepora | NA | NA | NA | NA | NA | C3-Am is expressed in response to injury, and may function as an opsonin | immunohistochemistry | 20600272 | 2010 | NA |
| PRRID_0675 | Mannose Click for more detail | NA | C(C1C(C(C(C(O1)O)O)O)O)O | NA | Carbohydrate | Natural | NA | Complement factor C3-like protein (C3-Am) | Pattern recognition receptor (PRR) | coral Acropora millepora | NA | NA | NA | NA | NA | C3-Am is expressed in response to injury, and may function as an opsonin | immunohistochemistry | 20600272 | 2010 | NA |
| PRRID_0749 | Phospholipomannan Click for more detail | Candida albicans(fungi) | NA | NA | Carbohydrate | Natural | Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD88,/TIRAP and aloow the rerutiment of downstream effector | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Cell surface | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | It leadsto the secretion of the proinfalmmatory cytokines | NA | 20620129 | 2010 | Pubchem Assay |
| PRRID_0749 | Phospholipomannan Click for more detail | Candida albicans(fungi) | NA | NA | Carbohydrate | Natural | Upon recogniton by the TLR, it induces induces the recruitment of adaptor proteins MyD88,/TIRAP and aloow the rerutiment of downstream effector | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Cell surface | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | It leadsto the secretion of the proinfalmmatory cytokines | NA | 20620129 | 2010 | Pubchem Assay |
| PRRID_0774 | Polyporus polysaccharide Click for more detail | NA | NA | NA | Carbohydrate | Natural | enhanced cell-surface expression of CD86 and production of both interleukin (IL)-12p40 and IL-10 | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | bone derived dendritic cells | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | It involved in BMDCs maturation by inducing phenotypic and functional hanges | ELISA | 20673883 | 2010 | Pubchem Assay |
| PRRID_0774 | Polyporus polysaccharide Click for more detail | NA | NA | NA | Carbohydrate | Natural | enhanced cell-surface expression of CD86 and production of both interleukin (IL)-12p40 and IL-10 | Toll-like receptor 4 (TLR4) | Toll-like receptor (TLR) | Mice (Murine) | bone derived dendritic cells | Leucine-rich Repeat (LRR) Domain | Q9QUK6.fasta | Q9QUK6 | 835 | It involved in BMDCs maturation by inducing phenotypic and functional hanges | ELISA | 20673883 | 2010 | Pubchem Assay |
| PRRID_0779 | PS-G Click for more detail | Ganoderma lucidum (fungi) | NA | NA | Carbohydrate | Natural | Binding resulted into the activation of NF- | Toll-like receptor 5 (TLR5) | Toll-like receptor (TLR) | Mice (Murine) | bone derived dendritic cells | Leucine-rich Repeat (LRR) Domain | Q9JLF7.fasta | Q9JLF7 | 859 | promote the activation and maturation of BMDCs and macrophages | NA | 20673883 | 2010 | Pubchem Assay |
| PRRID_0779 | PS-G Click for more detail | Ganoderma lucidum (fungi) | NA | NA | Carbohydrate | Natural | Binding resulted into the activation of NF- | Toll-like receptor 5 (TLR5) | Toll-like receptor (TLR) | Mice (Murine) | bone derived dendritic cells | Leucine-rich Repeat (LRR) Domain | Q9JLF7.fasta | Q9JLF7 | 859 | promote the activation and maturation of BMDCs and macrophages | NA | 20673883 | 2010 | Pubchem Assay |