Detailed description page of PRRDB2.0
| This page displays user query in tabular form. |
PRRID_0218 details |
| Primary information | |
|---|---|
| PRRID | PRRID_0218 |
| Ligand Name | Biglycan |
| Source | Endogenous (others) |
| Sequence of ligand | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYVRSWEEPAGLQQRAGVRALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLT |
| Length | 238 |
| Type | Carbohydrate |
| Occurence | Natural |
| Role of Ligand | Immunostimulant |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | Macrophages |
| Domain | NA |
| Sequence of Receptor | O00206.fasta |
| Swiss prot ID | O00206 |
| Length Of Receptor | 839 |
| Function | synthesis of TNF-alpha and MIP-2. |
| Assay used | Western blotting and ELISA. |
| PMID | 16025156 |
| Year of Publication | 2005 |
| Pubchem assay | Pubchem Assay |
| Primary information | |
|---|---|
| PRRID | PRRID_0218 |
| Ligand Name | Biglycan |
| Source | Endogenous (others) |
| Sequence of ligand | MWPLWRLVSLLALSQALPFEQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYVRSWEEPAGLQQRAGVRALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLT |
| Length | 238 |
| Type | Carbohydrate |
| Occurence | Natural |
| Role of Ligand | Immunostimulant |
| Name of receptor | Toll-like receptor 4 (TLR4) |
| Type of receptor | Toll-like receptor (TLR) |
| Source | Human |
| Localization | Macrophages |
| Domain | NA |
| Sequence of Receptor | O00206.fasta |
| Swiss prot ID | O00206 |
| Length Of Receptor | 839 |
| Function | synthesis of TNF-alpha and MIP-2. |
| Assay used | Western blotting and ELISA. |
| PMID | 16025156 |
| Year of Publication | 2005 |
| Pubchem assay | Pubchem Assay |