1115 | FK506 (tracrolimus) Ascomycin (pimecrolimus,SDZ ASM 981) | not available | 0 | L | None | None | None | Cyclic | Natural | Streptomyces tsukubaensis (bacteria) | Calcineurin | Inhibition of calcineurin by complex with FK binding proteins | Both | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
1116 | Homophymines | not available | 0 | L | None | None | None | Cyclic | Natural | Homophymia spp. (marine sponge) | NA | Antiproliferative, mechanism unknown | In vitro | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
1117 | Geodiamolides H | not available | 0 | L | None | None | None | Cyclic | Natural | Geodia corticostylifera (marine sponge) | Actin filaments | Disorganization of actin filaments | In vitro | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
1118 | Hymenistatin I | not available | 0 | L | None | None | None | Cyclic | Natural | Hymeniucidon spp. (marine sponge) | NA | Modulation of the IL2 cell response (comparable with rapamycin) | In vivo | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
1119 | Jasplakinolide | not available | 0 | L | None | None | None | Cyclic | Natural | Jaspis splendens (marine sponge) | Actin | Actin stabilization, induces actin polymerization | In vitro | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
1120 | Sirolimus (rapamycin), everolimus (and derivatives) | not available | 0 | L | None | None | None | Cyclic | Natural | Streptomyces hygroscopius (bacteria) | mTOR | Inhibition of mTOR | Both | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
1121 | Charybdotoxin (Venom peptide) | XFTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS | 37 | L | None | None | X=PyroGlutamic acid | Linear | Natural | Leiurus quinquestriatus hebraeus (scorpion) | K+ (potassium) channel | Potassium channel blocker | In vitro | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
1122 | Curcacycline B (Orbitide) | LGSPILLGI | 9 | L | None | None | None | Cyclic | Natural | Jatropha curcas (plant) | PPIase | PPIase inhbitior | In vitro | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
1123 | Cycloleonurinin (Orbitide) | GPTQYPPYYlTP | 13 | Mix | None | None | None | Cyclic | Natural | Leonurus heterophyllus (plant) | NA | Not known | In vitro | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
1124 | Cyclolinopeptide A/B (Orbitide) | IMLIPPFFV | 9 | L | None | None | None | Cyclic | Natural | Linum usitatissimum (plant) | Calcineurin | CYPA binding and calcineurin inhibition | In vivo | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
1125 | Iberiotoxin (Venom peptide) | XFTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ | 37 | L | None | None | X=Pyroglutamic acid and disulfile linkage at Disulfide bridges: Cys7 - Cys28, Cys13 - Cys33, Cys17 - Cys35 | Linear | Natural | Buthus tamulus (scorpion) | Blocker of several BK channels | Bloackion channels | Both | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
1126 | Kalata B1 (Cyclotide) | GLPVCGETCVGGTCNTPGCTCSWPVCTRN | 29 | L | None | None | Three Disulfide linkage (CI-CIV, CII-CV and CIII-CVI) | Cyclic | Natural | Oldenlandia affinis (plant) | IL-2 | Antiproliferative, IL2-dependent mechanism | Both | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
1127 | Kaliotoxin (Venom peptide) | GVEINVKCSGSPQCLKPCLDAGMRFGKCMNRKCHCTPK | 38 | L | None | None | None | Linear | Natural | Androctonus mauretanicus (scorpion) | K+ channel | Potassium channel blocker | In vitro | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
1128 | Magatoxin (Venom peptide) | IINVKCTSPKQCLPPCKAQFGQSAGAKCMNGKCKCYPH | 39 | L | None | None | disulfide bridges between Cys 7-Cys29, Cys13-Cys34 and Cys17-Cys36 | Linear | Natural | Centruroides margaritatus (scorpion) | K+ channel | Potassium channel blocker | In vivo | NA | NA | NA | NA | NA | NA | 24333193 | 2014 |
1129 | OSK-1 (alpha-KTx3.7) (Venom peptide) | GVIINVKCKISRQCLEPCKKAGMRFGKCMNGKCHCTPK | 38 | L | None | None | None | Linear | Natural | Orthochirus scrobiculosus (scorpion) | K+ channel | Potassium channel blocker | Both | NA | NA | C57/BL6 mice | NA | 10 mg/kg | NA | 24333193 | 2014 |
1130 | CKS-17 | LQNRRGLDLLFLKEGGLC | 18 | L | None | None | None | Linear | Protein Derived | murine leukemia virus (MLV) | TNF-α | Significantly reduces the mRNA levels of IL-17C, TNF-α, IL-6 and CXCL2 | Both | Acute allergic contact dermatitis model and TPA toxic eczema model | NA | C57BL/6 mice and BALB/CJ mice | NA | NA | NA | 24245569 | 2013 |
1131 | core peptide (CP) | GLRILLLKV | 9 | L | None | None | None | Linear | Protein Derived | T-cell antigen receptor alpha-chain transmembrane region | IL-2 | Inhibits IL-2 production | In vitro | Alanine scan, LK antigen-presenting cells | NA | NA | Antigen presentation assay, CTLL assay | NA | NA | 23066996 | 2013 |
1132 | Vm24 | AAAISCVGSPECPPKCRAQGCKNGKCMNRKCKCYYC | 36 | L | None | None | None | Linear | Natural | Vaejovis mexicanus smithi (scorpion) | Kv1.3 channels | Inhibits Kv1.3 channels | Both | COS-7, human embryonic kidney 293, tsA201, L929 and MEL cells | NA | Female Lewis rat (9-10 weeks of age) | Proliferation assay | NA | NA | 22622363 | 2012 |
1134 | Thalassospiramide A | not available | 0 | L | None | None | None | Cyclic | Natural | α-proteobacterium (strain CNJ-328) | IL-5 | Inhibition of IL-5 | In vitro | lymphocytes | 10 micromolar | NA | NA | NA | NA | 17373804 | 2007 |
1135 | Thalassospiramide B | not available | 0 | L | None | None | None | Cyclic | Natural | α-proteobacterium (strain CNJ-328) | IL-5 | Inhibition of IL-6 | In vitro | lymphocytes | 5 micromolar | NA | NA | NA | NA | 17373804 | 2007 |
1136 | Nonapeptide of HLA-DR | VPRSGEVYT | 9 | L | None | None | None | Linear | Synthetic | NA | NA | NA | Both | Spleen Cells | NA | CBA, BALB/c and C57BL, 8-12 weeks old mice | Plaque-forming cells (PFC) and delayed type hypersensitivity (DTH) assay | NA | NA | 15063002 | 2004 |
1137 | Lympho-inhibitory peptide | not available | 26 | NA | None | None | None | Linear | Natural | Mycoplasma bovis | NA | NA | In vitro | Bovine peripheral blood mononuclear cells (PBMCs) | NA | NA | NA | NA | NA | 14766212 | 2004 |
1138 | VIVIT (fused with GST) | VIVIT | 5 | L | None | None | None | Linear | Synthetic | NA | NFAT | Inhibits NFAT activation | In vitro | COS7 cells, HeLa cells, BHK cells, and NIH3T3 cells | NA | Hippocampal primary neurons of rat | NA | NA | fused with GST | 12763035 | 2003 |
1139 | Cyclosporin A (CsA) | cyclo[Abu-Sar-N(Me)Leu-Val-N(Me)Leu-Ala-D-Ala-N(Me)Leu-N(Me)Leu-N(Me)Val-N(Me)Bmt(E)] | 11 | Mix | None | None | Bmt = butenyl-methyl-threonine, Abu = L-alpha-aminobutyric acid, Sar = sarcosine, N(Me) = Amino acid is N-methylated | Cyclic | Natural | Fungus | NA | Inhibits virus-induced polykaryocyte formation and the production of infectious measles virus | In vitro | Vero cells (Persistently infected Vero cells (448-PI-Vero)) | 5micromolar | NA | NA | NA | NA | 11509881 | 2001 |
1140 | CKS-17 | LQNRRGLDLLFLKEGGL | 17 | L | None | None | None | Linear | Synthetic | NA | Protein kinase | Activates mitogen-activated protein (MAP) kinases extracellular signal-regulated kinase 1 and 2 (ERK1/2) | In vitro | Human monocytic cell line THP-1 | NA | NA | NA | NA | NA | 11359835 | 2001 |
1141 | Glycodelin-A | MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF | 180 | L | None | None | None | Linear | Protein Derived | NA | IL-2 | Glycodelin-A interrupts the production of interleukin-2 (IL-2) by lymphocytes and inhibits the IL-2 activation of natural killer cells | In vitro | Cervical tissue | NA | NA | NA | NA | NA | 11063647 | 2000 |
1142 | RDP1258 | RNleNleNleRNleNleNleGY | 22 | L | None | Amidation | None | Linear | Protein Derived | NA | TNF-α | Enhanced expression of splenic heme oxygenase 1 (HO-1). Decreased expression of tumor necrosis factor a (TNF-α) mRNA; and an increased level of inducible nitric oxide synthase (iNOS) mRNA. | In vivo | NA | 20 micromolar | Eight- to 12-week-old male Lewis.lW (RTI.u) and Lewis.lA (RTI.')rats | Graft transplation assay | NA | NA | 10666482 | 2000 |
1143 | HLA B-2702 (2702.75-84) | RENLRIALRY | 10 | L | None | None | None | Linear | Natural | NA | T-cell | Inhibits the differentiation of cytotoxic T cells and also decrease natural killer (NK) cell-mediated cytotoxicity | In vivo | NA | NA | Eight- to 12-week-old male Lewis.lW (RTI.u) and Lewis.lA (RTI.')rats | Graft transplation assay | NA | NA | 10666482 | 2000 |
1144 | B-0701 (07.75-84) | RESLRNLRGY | 10 | L | None | None | None | Linear | Natural | NA | T-cell | Inhibits the differentiation of cytotoxic T cells and also decrease natural killer (NK) cell-mediated cytotoxicity | In vivo | NA | 200 micromolar | Eight- to 12-week-old male Lewis.lW (RTI.u) and Lewis.lA (RTI.')rats | Graft transplation assay | NA | NA | 10666482 | 2000 |
1145 | Cyclosporin A (CsA) | cyclo[Abu-Sar-N(Me)Leu-Val-N(Me)Leu-Ala-D-Ala-N(Me)Leu-N(Me)Leu-N(Me)Val-N(Me)Bmt(E)] | 11 | Mix | None | None | Bmt = butenyl-methyl-threonine, Abu = L-alpha-aminobutyric acid, Sar = sarcosine, N(Me) = Amino acid is N-methylated | Cyclic | Natural | Fungus | NA | Not Available | In vivo | NA | NA | Eight- to 12-week-old male Lewis.lW (RTI.u) and Lewis.lA (RTI.')rats | Graft transplation assay | NA | NA | 10666482 | 2000 |
1146 | HLA-B2702 (2702.75-84) | RENLRIALRY | 10 | L | None | None | None | Linear | Natural | Heavy chain of HLA class I | NA | Not Available | Both | In silico screening (MD simulations) | 1.0±0.4 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
1147 | 2702.84-75 | YRLAIRLNER | 10 | L | None | None | None | Linear | Natural | Heavy chain of HLA class I | NA | Not Available | Both | In silico screening (MD simulations) | 1.2 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
1148 | D2702.75-84 | renrialry | 9 | D | None | None | None | Linear | Natural | Heavy chain of HLA class I | NA | Not Available | Both | In silico screening (MD simulations) | 0.15±0.05 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
1149 | D2702.84-75 | yrlairlner | 10 | D | None | None | None | Linear | Natural | Heavy chain of HLA class I | NA | Not Available | Both | In silico screening (MD simulations) | 0.3 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
1150 | P2 | RVNLRIALRY | 10 | L | None | None | None | Linear | Natural | Heavy chain of HLA class I | NA | Not Available | Both | In silico screening (MD simulations) | 0.15±0.08 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
1151 | RP2 | YRLAIRLNVR | 10 | L | None | None | None | Linear | Natural | Heavy chain of HLA class I | NA | Not Available | Both | In silico screening (MD simulations) | 0.2 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
1152 | D2 | rvnlrialry | 10 | D | None | None | None | Linear | Natural | Heavy chain of HLA class I | NA | Not Available | Both | In silico screening (MD simulations) | 0.17±0.09 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
1153 | RD2 | yrlairlnvr | 10 | D | None | None | None | Linear | Natural | Heavy chain of HLA class I | NA | Not Available | Both | In silico screening (MD simulations) | 0.3 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
1154 | P15 | NLRIALAYYW | 10 | L | None | None | None | Linear | Natural | Heavy chain of HLA class I | NA | Not Available | Both | In silico screening (MD simulations) | 0.2 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
1155 | RDP1257 | RLLLRLLLGY | 10 | L | None | None | None | Linear | Natural | HLA/MHC molecule | NA | Not Available | Both | In silico screening (MD simulations) | 1.4±0.2 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
1156 | RDP1259 | RVLLRLLLGY | 10 | L | None | None | None | Linear | Natural | HLA/MHC molecule | NA | Not Available | Both | In silico screening (MD simulations) | 1.4±0.15 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
1157 | RDP1271 | RWLLRLLLGY | 10 | L | None | None | None | Linear | Natural | HLA/MHC molecule | NA | Not Available | Both | In silico screening (MD simulations) | 1.4±0.3 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
1158 | RDP1277 | RYLLALLLGY | 10 | L | None | None | None | Linear | Natural | HLA/MHC molecule | NA | Not Available | Both | In silico screening (MD simulations) | 1.4±0.2 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
1159 | RDP1258 | RnlnlnLRnlnLnLGY | 16 | Mix | None | None | None | Linear | Natural | HLA/MHC molecule | NA | Not Available | Both | In silico screening (MD simulations) | 1.2±0.2 micromolar | CBA and C57BI/6 mice | Graft transplation assay | NA | NA | 9702773 | 1998 |
1161 | HIV-env 579-595 | GIKQLQARILAVERYLK | 17 | L | None | None | None | Linear | Synthetic | NA | NA | Not Available | In vitro | Human sera | NA | NA | NA | NA | NA | 2455899 | 1988 |
1162 | HIV-env 583-599 (pHIVIS) | LQARILAVERYLKDQQL | 17 | L | None | None | None | Linear | Synthetic | NA | NA | Not Available | In vitro | Human sera | NA | NA | NA | NA | NA | 2455899 | 1988 |
1163 | HIV-env:inv 599-583 | LQQDKLYREVALIRAQL | 17 | L | None | None | None | Linear | Synthetic | NA | NA | Not Available | In vitro | Human sera | NA | NA | NA | NA | NA | 2455899 | 1988 |
1164 | HIV-env 586-606 | RILAVERYLKDQQLLGIWGCS | 21 | L | None | None | None | Linear | Synthetic | NA | NA | Not Available | In vitro | Human sera | NA | NA | NA | NA | NA | 2455899 | 1988 |
1165 | HIV-env 587-603 | ILAVERYLKDQQLLGIW | 17 | L | None | None | None | Linear | Synthetic | NA | NA | Not Available | In vitro | Human sera | NA | NA | NA | NA | NA | 2455899 | 1988 |
1166 | HIV-env 654-666 | EESQNQQEKNEQE | 13 | L | None | None | None | Linear | Synthetic | NA | NA | Not Available | In vitro | Human sera | NA | NA | NA | NA | NA | 2455899 | 1988 |