| This page displays user query in tabular form. |
1141 details |
| Primary information | |
|---|---|
| ID | 1141 |
| Peptide Name | Glycodelin-A |
| Sequence | MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF |
| Length | 180 |
| Chirality | L |
| N-terminal Modification | None |
| C-terminal Modification | None |
| Chemical Modification | None |
| Linear/ Cyclic | Linear |
| Nature | Protein Derived |
| Source of Origin | NA |
| Target | IL-2 |
| Mechanism of Action | Glycodelin-A interrupts the production of interleukin-2 (IL-2) by lymphocytes and inhibits the IL-2 activation of natural killer cells |
| In vitro/In vivo | In vitro |
| Cell Line | Cervical tissue |
| Inhibition Concentartion | NA |
| In vivo Model | NA |
| Assay | NA |
| Lethal Dose | NA |
| Combination Therapy | NA |
| Pubmed ID | 11063647 |
| Year of Publication | 2000 |
| 3-D Structure | NA |