Browse result page of PRRDB 2.0
| PRRID | Name of Ligand | Source of ligand | Sequence of Ligand | Length of Ligand | Type of Ligand | Occurence | Role of Ligand | Name of Receptor | Type of Reeptor | Source of the Receptor | Localization | Domain | Sequence of Receptor | Swiss prot ID | Length of receptor | Function of Receptor | Assay used | PMID | Year of publication | Pubchem assay |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| PRRID_0009 | Acetylated LDL Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Immunostimulant | Scavenger receptor A I (SR-A I) | Scavenger receptor (SR) | NA | NA | NA | NA | NA | NA | NA | NA | 2300204 | 1991 | NA |
| PRRID_0009 | Acetylated LDL Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Immunostimulant | Scavenger receptor A I (SR-A I) | Scavenger receptor (SR) | NA | NA | NA | NA | NA | NA | NA | NA | 2300204 | 1991 | NA |
| PRRID_0010 | Advanced Glycation End Products (AGE) Click for more detail | Endogenous (others) | NA | NA | Lipoprotein | Natural | Immunostimulant | Scavenger receptor A I (SR-A I) | Scavenger receptor (SR) | NA | NA | NA | NA | NA | NA | NA | NA | 2300204 | 1991 | NA |
| PRRID_0010 | Advanced Glycation End Products (AGE) Click for more detail | Endogenous (others) | NA | NA | Lipoprotein | Natural | Immunostimulant | Scavenger receptor A I (SR-A I) | Scavenger receptor (SR) | NA | NA | NA | NA | NA | NA | NA | NA | 2300204 | 1991 | NA |
| PRRID_0015 | oxidized LDL (OxLDL) Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Immunostimulant | Scavenger receptor A I (SR-A I) | Scavenger receptor (SR) | NA | NA | NA | NA | NA | NA | NA | NA | 2300204 | 1991 | NA |
| PRRID_0015 | oxidized LDL (OxLDL) Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Immunostimulant | Scavenger receptor A I (SR-A I) | Scavenger receptor (SR) | NA | NA | NA | NA | NA | NA | NA | NA | 2300204 | 1991 | NA |
| PRRID_0021 | Acetylated LDL Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Immunostimulant | cluster of differentiation 36 (CD36) | Pattern recognition receptor (PRR) | NA | NA | NA | NA | NA | NA | NA | NA | 7685021 | 1993 | NA |
| PRRID_0021 | Acetylated LDL Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Immunostimulant | cluster of differentiation 36 (CD36) | Pattern recognition receptor (PRR) | NA | NA | NA | NA | NA | NA | NA | NA | 7685021 | 1993 | NA |
| PRRID_0024 | High Density Lipoprotein (HDL) Click for more detail | Endogenous (others) | CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C | NA | Lipoprotein | Natural | Immunostimulant | cluster of differentiation 36 (CD36) | Pattern recognition receptor (PRR) | NA | NA | NA | NA | NA | NA | NA | NA | 7685021 | 1993 | NA |
| PRRID_0024 | High Density Lipoprotein (HDL) Click for more detail | Endogenous (others) | CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C | NA | Lipoprotein | Natural | Immunostimulant | cluster of differentiation 36 (CD36) | Pattern recognition receptor (PRR) | NA | NA | NA | NA | NA | NA | NA | NA | 7685021 | 1993 | NA |
| PRRID_0026 | oxidized LDL (OxLDL) Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Immunostimulant | cluster of differentiation 36 (CD36) | Pattern recognition receptor (PRR) | NA | NA | NA | NA | NA | NA | NA | NA | 7685021 | 1993 | NA |
| PRRID_0026 | oxidized LDL (OxLDL) Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Immunostimulant | cluster of differentiation 36 (CD36) | Pattern recognition receptor (PRR) | NA | NA | NA | NA | NA | NA | NA | NA | 7685021 | 1993 | NA |
| PRRID_0032 | Acetylated LDL Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Immunostimulant | dSR-C1 | Scavenger receptor (SR) | Drosophila melanogaster | NA | two complement control protein (CCP) domains and somatomedin B, MAM, and mucin-like domains | NA | NA | NA | NA | NA | 7732030 | 1995 | NA |
| PRRID_0032 | Acetylated LDL Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Immunostimulant | dSR-C1 | Scavenger receptor (SR) | Drosophila melanogaster | NA | two complement control protein (CCP) domains and somatomedin B, MAM, and mucin-like domains | NA | NA | NA | NA | NA | 7732030 | 1995 | NA |
| PRRID_0033 | Acetylated LDL Click for more detail | NA | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Acetylated LDL is a potent ligand for MARCO | Macrophage receptor with collagenous structure (MARCO) | Scavenger receptor (SR) | Mice | Macrophages | NA | A2RT24.fasta | A2RT24 | 518 | It plays a role in immunological reactions. | Immunoprecipitation | 7867067 | 1995 | Pubchem Assay |
| PRRID_0033 | Acetylated LDL Click for more detail | NA | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Acetylated LDL is a potent ligand for MARCO | Macrophage receptor with collagenous structure (MARCO) | Scavenger receptor (SR) | Mice | Macrophages | NA | A2RT24.fasta | A2RT24 | 518 | It plays a role in immunological reactions. | Immunoprecipitation | 7867067 | 1995 | Pubchem Assay |
| PRRID_0034 | Acetylated LDL Click for more detail | Host (Endogenous) (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Acetylated-LDL is a potent activator of MSR. | Macrophage Scavenger Receptor (MSR) | Scavenger receptor (SR) | Human | Macrophages | NA | P21757.fasta | P21757 | 451 | The MSR mediates the endocytic uptake and degradation of LDL. | NA | 7607209 | 1995 | Pubchem Assay |
| PRRID_0034 | Acetylated LDL Click for more detail | Host (Endogenous) (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Acetylated-LDL is a potent activator of MSR. | Macrophage Scavenger Receptor (MSR) | Scavenger receptor (SR) | Human | Macrophages | NA | P21757.fasta | P21757 | 451 | The MSR mediates the endocytic uptake and degradation of LDL. | NA | 7607209 | 1995 | Pubchem Assay |
| PRRID_0055 | Acetylated LDL Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Immunostimulant | Scavenger receptor expressed by endothelial cells 1 | Scavenger receptor (SR) | Chinese Hamster | Chinese hamster ovary cells | Lectin-like domains | NA | NA | NA | NA | ELISA | 9395444 | 1997 | NA |
| PRRID_0055 | Acetylated LDL Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Immunostimulant | Scavenger receptor expressed by endothelial cells 1 | Scavenger receptor (SR) | Chinese Hamster | Chinese hamster ovary cells | Lectin-like domains | NA | NA | NA | NA | ELISA | 9395444 | 1997 | NA |
| PRRID_0056 | Acetylated LDL Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Immunostimulant | Lectin-like oxidized LDLreceptor 1 | C type Lectin (CTL/CLR) | NA | vascular endothelium and vascular-rich organs. | NA | NA | NA | NA | NA | NA | 9052782 | 1997 | NA |
| PRRID_0056 | Acetylated LDL Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Immunostimulant | Lectin-like oxidized LDLreceptor 1 | C type Lectin (CTL/CLR) | NA | vascular endothelium and vascular-rich organs. | NA | NA | NA | NA | NA | NA | 9052782 | 1997 | NA |
| PRRID_0057 | Acetylated LDL Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | elicit innate immune response | Scavenger receptor A II | Scavenger receptor (SR) | Mice | Macrophages | NA | Q08857.fasta | Q08857 | 472 | production of pro-inflammatory cytokines | NA | 9069289 | 1997 | Pubchem Assay |
| PRRID_0057 | Acetylated LDL Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | elicit innate immune response | Scavenger receptor A II | Scavenger receptor (SR) | Mice | Macrophages | NA | Q08857.fasta | Q08857 | 472 | production of pro-inflammatory cytokines | NA | 9069289 | 1997 | Pubchem Assay |
| PRRID_0062 | oxidized LDL (OxLDL) Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Immunostimulant | Scavenger receptor expressed by endothelial cells 1 | Scavenger receptor (SR) | Chinese Hamster | Chinese hamster ovary cells | Lectin-like domains | NA | NA | NA | NA | ELISA | 9395444 | 1997 | NA |
| PRRID_0062 | oxidized LDL (OxLDL) Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Immunostimulant | Scavenger receptor expressed by endothelial cells 1 | Scavenger receptor (SR) | Chinese Hamster | Chinese hamster ovary cells | Lectin-like domains | NA | NA | NA | NA | ELISA | 9395444 | 1997 | NA |
| PRRID_0063 | oxidized LDL (OxLDL) Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Immunostimulant | Lectin-like oxidized LDLreceptor 1 | C type Lectin (CTL/CLR) | NA | vascular endothelium and vascular-rich organs. | NA | NA | NA | NA | NA | NA | 9052782 | 1997 | NA |
| PRRID_0063 | oxidized LDL (OxLDL) Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Immunostimulant | Lectin-like oxidized LDLreceptor 1 | C type Lectin (CTL/CLR) | NA | vascular endothelium and vascular-rich organs. | NA | NA | NA | NA | NA | NA | 9052782 | 1997 | NA |
| PRRID_0064 | oxidized LDL (OxLDL) Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | elicit innate immune response | Scavenger receptor A II | Scavenger receptor (SR) | Mice | Macrophages | NA | Q08857.fasta | Q08857 | 472 | production of pro-inflammatory cytokines | NA | 9069289 | 1997 | Pubchem Assay |
| PRRID_0064 | oxidized LDL (OxLDL) Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | elicit innate immune response | Scavenger receptor A II | Scavenger receptor (SR) | Mice | Macrophages | NA | Q08857.fasta | Q08857 | 472 | production of pro-inflammatory cytokines | NA | 9069289 | 1997 | Pubchem Assay |
| PRRID_0065 | Acetylated LDL Click for more detail | Host (Endogenous) (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | AcLDL pretreatment increased expression of macrosialin | Microsialin | Scavenger receptor (SR) | Mice | Peritoneal macrophages | NA | A0A0R4J1C8.fasta | A0A0R4J1C8 | 335 | It leads to the binding and uptake of oxidised form of LDL by resident mouse peritoneal macrophages. | Endocytic degradation assays | 9598839 | 1998 | Pubchem Assay |
| PRRID_0065 | Acetylated LDL Click for more detail | Host (Endogenous) (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | AcLDL pretreatment increased expression of macrosialin | Microsialin | Scavenger receptor (SR) | Mice | Peritoneal macrophages | NA | A0A0R4J1C8.fasta | A0A0R4J1C8 | 335 | It leads to the binding and uptake of oxidised form of LDL by resident mouse peritoneal macrophages. | Endocytic degradation assays | 9598839 | 1998 | Pubchem Assay |
| PRRID_0068 | High Density Lipoprotein (HDL) Click for more detail | Host (Endogenous) (others) | CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C | NA | Lipoprotein | Natural | CD36 is a high affinity receptor for the native lipoproteins LDL. | cluster of differentiation 36 (CD36) | Pattern recognition receptor (PRR) | Human | Monocytes/Macrophages | NA | P16671.fasta | P16671 | 472 | Lipoprotein binding assay | NA | 9555943 | 1998 | Pubchem Assay |
| PRRID_0068 | High Density Lipoprotein (HDL) Click for more detail | Host (Endogenous) (others) | CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C | NA | Lipoprotein | Natural | CD36 is a high affinity receptor for the native lipoproteins LDL. | cluster of differentiation 36 (CD36) | Pattern recognition receptor (PRR) | Human | Monocytes/Macrophages | NA | P16671.fasta | P16671 | 472 | Lipoprotein binding assay | NA | 9555943 | 1998 | Pubchem Assay |
| PRRID_0069 | Low Density Lipoprotein (LDL) Click for more detail | Host (Endogenous) (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | CD36 is a high affinity receptor for the native lipoproteins HDL. | cluster of differentiation 36 (CD36) | Pattern recognition receptor (PRR) | Human | Monocytes/Macrophages | NA | P16671.fasta | P16671 | 472 | Lipoprotein binding assay | NA | 9555943 | 1998 | Pubchem Assay |
| PRRID_0069 | Low Density Lipoprotein (LDL) Click for more detail | Host (Endogenous) (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | CD36 is a high affinity receptor for the native lipoproteins HDL. | cluster of differentiation 36 (CD36) | Pattern recognition receptor (PRR) | Human | Monocytes/Macrophages | NA | P16671.fasta | P16671 | 472 | Lipoprotein binding assay | NA | 9555943 | 1998 | Pubchem Assay |
| PRRID_0070 | Minimally oxidized LDL (MM-LDL) Click for more detail | Host (Endogenous) (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | MM-LDL pretreatment induced a clear increase of cell association and increase both mRNAlevels and protein levels of scavenger receptor A, CD36, and macrosialin. | Microsialin | Scavenger receptor (SR) | Mice | Peritoneal macrophages | NA | A0A0R4J1C8.fasta | A0A0R4J1C8 | 335 | It leads to the binding and uptake of oxidised form of LDL by resident mouse peritoneal macrophages. | Endocytic degradation assays | 9598839 | 1998 | Pubchem Assay |
| PRRID_0070 | Minimally oxidized LDL (MM-LDL) Click for more detail | Host (Endogenous) (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | MM-LDL pretreatment induced a clear increase of cell association and increase both mRNAlevels and protein levels of scavenger receptor A, CD36, and macrosialin. | Microsialin | Scavenger receptor (SR) | Mice | Peritoneal macrophages | NA | A0A0R4J1C8.fasta | A0A0R4J1C8 | 335 | It leads to the binding and uptake of oxidised form of LDL by resident mouse peritoneal macrophages. | Endocytic degradation assays | 9598839 | 1998 | Pubchem Assay |
| PRRID_0071 | oxidized LDL (OxLDL) Click for more detail | Host (Endogenous) (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | OxLDL pretreatment increased expression of macrosialin. | Microsialin | Scavenger receptor (SR) | Mice | Peritoneal macrophages | NA | A0A0R4J1C8.fasta | A0A0R4J1C8 | 335 | It leads to the binding and uptake of oxidised form of LDL by resident mouse peritoneal macrophages. | Endocytic degradation assays | 9598839 | 1998 | Pubchem Assay |
| PRRID_0071 | oxidized LDL (OxLDL) Click for more detail | Host (Endogenous) (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | OxLDL pretreatment increased expression of macrosialin. | Microsialin | Scavenger receptor (SR) | Mice | Peritoneal macrophages | NA | A0A0R4J1C8.fasta | A0A0R4J1C8 | 335 | It leads to the binding and uptake of oxidised form of LDL by resident mouse peritoneal macrophages. | Endocytic degradation assays | 9598839 | 1998 | Pubchem Assay |
| PRRID_0072 | Very Low Density Lipoprotein (VLDL) Click for more detail | Host (Endogenous) (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | CD36 is a high affinity receptor for the native lipoproteins VLDL. | cluster of differentiation 36 (CD36) | Pattern recognition receptor (PRR) | Human | Monocytes/Macrophages | NA | P16671.fasta | P16671 | 472 | Lipoprotein binding assay | NA | 9555943 | 1998 | Pubchem Assay |
| PRRID_0072 | Very Low Density Lipoprotein (VLDL) Click for more detail | Host (Endogenous) (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | CD36 is a high affinity receptor for the native lipoproteins VLDL. | cluster of differentiation 36 (CD36) | Pattern recognition receptor (PRR) | Human | Monocytes/Macrophages | NA | P16671.fasta | P16671 | 472 | Lipoprotein binding assay | NA | 9555943 | 1998 | Pubchem Assay |
| PRRID_0076 | Acetylated LDL Click for more detail | Host (Endogenous) (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | It binds to the CD36 with high affinity | cluster of differentiation 36 (CD36) | Pattern recognition receptor (PRR) | Human | CHO cells | NA | P16671.fasta | P16671 | 472 | CD36 mediates the endocytic uptake and subsequent intracellular degradation. | Cellular assay | 11035013 | 2000 | Pubchem Assay |
| PRRID_0076 | Acetylated LDL Click for more detail | Host (Endogenous) (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | It binds to the CD36 with high affinity | cluster of differentiation 36 (CD36) | Pattern recognition receptor (PRR) | Human | CHO cells | NA | P16671.fasta | P16671 | 472 | CD36 mediates the endocytic uptake and subsequent intracellular degradation. | Cellular assay | 11035013 | 2000 | Pubchem Assay |
| PRRID_0085 | High Density Lipoprotein (HDL) Click for more detail | Host (Endogenous) (others) | CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C | NA | Lipoprotein | Natural | It binds to the CD36 with high affinity | cluster of differentiation 36 (CD36) | Pattern recognition receptor (PRR) | Human | CHO cells | NA | P16671.fasta | P16671 | 472 | CD36 mediates the endocytic uptake and subsequent intracellular degradation. | Cellular assay | 11035013 | 2000 | Pubchem Assay |
| PRRID_0085 | High Density Lipoprotein (HDL) Click for more detail | Host (Endogenous) (others) | CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C | NA | Lipoprotein | Natural | It binds to the CD36 with high affinity | cluster of differentiation 36 (CD36) | Pattern recognition receptor (PRR) | Human | CHO cells | NA | P16671.fasta | P16671 | 472 | CD36 mediates the endocytic uptake and subsequent intracellular degradation. | Cellular assay | 11035013 | 2000 | Pubchem Assay |
| PRRID_0091 | oxidized LDL (OxLDL) Click for more detail | Host (Endogenous) (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Ox-LDL binds with SR-PSOX with high affinity. | Scavenger receptor PSOX (SR-PSOX) | Scavenger receptor (SR) | PMA treated THP-1 cells | Macrophages | NA | NA | NA | NA | SR-PSOX specifically binds with high affinity, internalize and degrade OxLDL, hence play important roles in pathophysiology including atherogenesis. | ELISA | 11060282 | 2000 | NA |
| PRRID_0091 | oxidized LDL (OxLDL) Click for more detail | Host (Endogenous) (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Ox-LDL binds with SR-PSOX with high affinity. | Scavenger receptor PSOX (SR-PSOX) | Scavenger receptor (SR) | PMA treated THP-1 cells | Macrophages | NA | NA | NA | NA | SR-PSOX specifically binds with high affinity, internalize and degrade OxLDL, hence play important roles in pathophysiology including atherogenesis. | ELISA | 11060282 | 2000 | NA |
| PRRID_0092 | oxidized LDL (OxLDL) Click for more detail | Host (Endogenous) (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Ox-LDL binds with SR-PSOX with high affinity. | Scavenger receptor PSOX (SR-PSOX) | Scavenger receptor (SR) | Human | Macrophages | NA | Q9H2A7.fasta | Q9H2A7 | 254 | SR-PSOX specifically binds with high affinity, internalize and degrade OxLDL, hence play important roles in pathophysiology including atherogenesis. | ELISA | 11060282 | 2000 | Pubchem Assay |
| PRRID_0092 | oxidized LDL (OxLDL) Click for more detail | Host (Endogenous) (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | Ox-LDL binds with SR-PSOX with high affinity. | Scavenger receptor PSOX (SR-PSOX) | Scavenger receptor (SR) | Human | Macrophages | NA | Q9H2A7.fasta | Q9H2A7 | 254 | SR-PSOX specifically binds with high affinity, internalize and degrade OxLDL, hence play important roles in pathophysiology including atherogenesis. | ELISA | 11060282 | 2000 | Pubchem Assay |
| PRRID_0093 | oxidized LDL (OxLDL) Click for more detail | Host (Endogenous) (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | It binds to the CD36 with high affinity | cluster of differentiation 36 (CD36) | Pattern recognition receptor (PRR) | Human | CHO cells | NA | P16671.fasta | P16671 | 472 | CD36 mediates the endocytic uptake and subsequent intracellular degradation. | Cellular assay | 11035013 | 2000 | Pubchem Assay |
| PRRID_0093 | oxidized LDL (OxLDL) Click for more detail | Host (Endogenous) (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Natural | It binds to the CD36 with high affinity | cluster of differentiation 36 (CD36) | Pattern recognition receptor (PRR) | Human | CHO cells | NA | P16671.fasta | P16671 | 472 | CD36 mediates the endocytic uptake and subsequent intracellular degradation. | Cellular assay | 11035013 | 2000 | Pubchem Assay |
| PRRID_0103 | Hypochlorite modified HDL Click for more detail | Endogenous (others) | CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C | NA | Lipoprotein | Natural | Immunostimulant | Lectin-like oxidized LDLreceptor 1 | C type Lectin (CTL/CLR) | NA | NA | NA | NA | NA | NA | induces pro-inflammatory cytokine response | NA | 11292679 | 2001 | NA |
| PRRID_0103 | Hypochlorite modified HDL Click for more detail | Endogenous (others) | CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C | NA | Lipoprotein | Natural | Immunostimulant | Lectin-like oxidized LDLreceptor 1 | C type Lectin (CTL/CLR) | NA | NA | NA | NA | NA | NA | induces pro-inflammatory cytokine response | NA | 11292679 | 2001 | NA |
| PRRID_0109 | oxidized LDL (OxLDL) Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Synthetic | Ox-LDL binds with SR-PSOX with high affinity. | Scavenger Receptor for PhosphatidylSerine and Oxidized lipoprotein (SR-PSOX) | Scavenger receptor (SR) | Human | Macrophages | NA | Q9H2A7.fasta | Q9H2A7 | 254 | SR-PSOX is involved in Ox-LDL uptake and subsequent foam cell transformation in macrophages in vivo and thus may play important roles in human atherosclerotic lesion formation. | ELISA | 11701468 | 2001 | Pubchem Assay |
| PRRID_0109 | oxidized LDL (OxLDL) Click for more detail | Endogenous (others) | CC1CCC2(C(C3C(O2)CC4C3(CCC5C4CCC6C5(CCC(C6)O)C)C)C)NC1 | NA | Lipoprotein | Synthetic | Ox-LDL binds with SR-PSOX with high affinity. | Scavenger Receptor for PhosphatidylSerine and Oxidized lipoprotein (SR-PSOX) | Scavenger receptor (SR) | Human | Macrophages | NA | Q9H2A7.fasta | Q9H2A7 | 254 | SR-PSOX is involved in Ox-LDL uptake and subsequent foam cell transformation in macrophages in vivo and thus may play important roles in human atherosclerotic lesion formation. | ELISA | 11701468 | 2001 | Pubchem Assay |
| PRRID_0132 | Hypochlorite modified HDL Click for more detail | Host (Endogenous) (others) | CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C | NA | Lipoprotein | Natural | It has a high affinity for the Lectin-like oxidized low density lipoprotein receptor 1 (LOX-1). | Lectin-like oxidized LDLreceptor 1 | C type Lectin (CTL/CLR) | Mice (Murine) | CHO Cells—ldlA cells | NA | Q9EQ09.fasta | Q9EQ09 | 363 | It impairs high density lipoprotein-dependent selective lipid uptake and reverse cholesterol transport. | NA | 12070141 | 2002 | Pubchem Assay |
| PRRID_0132 | Hypochlorite modified HDL Click for more detail | Host (Endogenous) (others) | CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C | NA | Lipoprotein | Natural | It has a high affinity for the Lectin-like oxidized low density lipoprotein receptor 1 (LOX-1). | Lectin-like oxidized LDLreceptor 1 | C type Lectin (CTL/CLR) | Mice (Murine) | CHO Cells—ldlA cells | NA | Q9EQ09.fasta | Q9EQ09 | 363 | It impairs high density lipoprotein-dependent selective lipid uptake and reverse cholesterol transport. | NA | 12070141 | 2002 | Pubchem Assay |
| PRRID_0133 | Hypochlorite modified HDL Click for more detail | Host (Endogenous) (others) | CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C | NA | Lipoprotein | Natural | It has a high affinity for the Lectin-like oxidized low density lipoprotein receptor 1 (LOX-1). | Scavenger receptor class B, type I (SR-BI) | Scavenger receptor (SR) | Mice (Murine) | CHO Cells—ldlA cells | NA | Q06BI8.fasta | Q06BI8 | 494 | It impairs high density lipoprotein-dependent selective lipid uptake and reverse cholesterol transport. | NA | 12070141 | 2002 | Pubchem Assay |
| PRRID_0133 | Hypochlorite modified HDL Click for more detail | Host (Endogenous) (others) | CC(C)CCCC(C)C1CCC2C1(CCC3C2CC=C4C3(CCC(C4)O)C)C | NA | Lipoprotein | Natural | It has a high affinity for the Lectin-like oxidized low density lipoprotein receptor 1 (LOX-1). | Scavenger receptor class B, type I (SR-BI) | Scavenger receptor (SR) | Mice (Murine) | CHO Cells—ldlA cells | NA | Q06BI8.fasta | Q06BI8 | 494 | It impairs high density lipoprotein-dependent selective lipid uptake and reverse cholesterol transport. | NA | 12070141 | 2002 | Pubchem Assay |
| PRRID_0143 | OspA Click for more detail | Borrelia burgdorferi(Bacteria) | MKKYLLGIGLILALIACKQNVSSLDEKNSVSVDLPGGMTVLVSKEKDKDGKYSLDATVDKLELKGTSDKNNGSGTLEGEKTDKSKVKLTIADDLSQTKFEIFKEDGKTLVSKKVTLKDKSSTEEKFNEKGETSEKTIVRANGTRLEYTDIKSDGSGKAKEVLKDFTLEGTLAADGKTTLKVTEGTVVLSKNILKSGEITVALDDSDTTQATKKTGNWDSKSSTLTISVNSQKTKNLVFTKEDTITVQKYDSAGTNLEGKAVEITTLKELKAALK | NA | Lipoprotein | Natural | immunostimulantt | Toll-like receptor 2 (TLR2)+unknown | Toll-like receptor (TLR) | Human | NA | NA | NA | NA | NA | human hyporesponsiveness to OspA vaccination | NA | 12091878 | 2002 | NA |
| PRRID_0143 | OspA Click for more detail | Borrelia burgdorferi(Bacteria) | MKKYLLGIGLILALIACKQNVSSLDEKNSVSVDLPGGMTVLVSKEKDKDGKYSLDATVDKLELKGTSDKNNGSGTLEGEKTDKSKVKLTIADDLSQTKFEIFKEDGKTLVSKKVTLKDKSSTEEKFNEKGETSEKTIVRANGTRLEYTDIKSDGSGKAKEVLKDFTLEGTLAADGKTTLKVTEGTVVLSKNILKSGEITVALDDSDTTQATKKTGNWDSKSSTLTISVNSQKTKNLVFTKEDTITVQKYDSAGTNLEGKAVEITTLKELKAALK | NA | Lipoprotein | Natural | immunostimulantt | Toll-like receptor 2 (TLR2)+unknown | Toll-like receptor (TLR) | Human | NA | NA | NA | NA | NA | human hyporesponsiveness to OspA vaccination | NA | 12091878 | 2002 | NA |
| PRRID_0257 | Lipoprotein Click for more detail | Gram-negative and Gram-positive bacteria | NA | NA | Lipoprotein | Natural | elicit innate immune response | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Peripheral blood mononuclear cells (PBMC) | cytoplasmic leucine rich repeat (LRR) | Q9QUN7.fasta | Q9QUN7 | 784 | plays a fundamental role in pathogen recognition and activation of innate immunity | ELISA | 17353199 | 2007 | Pubchem Assay |
| PRRID_0257 | Lipoprotein Click for more detail | Gram-negative and Gram-positive bacteria | NA | NA | Lipoprotein | Natural | elicit innate immune response | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Peripheral blood mononuclear cells (PBMC) | cytoplasmic leucine rich repeat (LRR) | Q9QUN7.fasta | Q9QUN7 | 784 | plays a fundamental role in pathogen recognition and activation of innate immunity | ELISA | 17353199 | 2007 | Pubchem Assay |
| PRRID_0258 | Lipoprotein Click for more detail | Bacteria | NA | NA | Lipoprotein | Natural | elicit innate immune response | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | BALB/c and C57BL/6 mice | Spleen cells | Toll- IL-1R domain | Q9QUN7.fasta | Q9QUN7 | 784 | plays a fundamental role in pathogen recognition and activation of innate immunity | NA | 17404301 | 2007 | Pubchem Assay |
| PRRID_0258 | Lipoprotein Click for more detail | Bacteria | NA | NA | Lipoprotein | Natural | elicit innate immune response | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | BALB/c and C57BL/6 mice | Spleen cells | Toll- IL-1R domain | Q9QUN7.fasta | Q9QUN7 | 784 | plays a fundamental role in pathogen recognition and activation of innate immunity | NA | 17404301 | 2007 | Pubchem Assay |
| PRRID_0260 | N-ALP1 Click for more detail | Mycoplasma pneumoniae (Bacteria) | NA | NA | Lipoprotein | Natural | It induces the activation of NF-kappaB and induces the expression levels of interleukin-6 (IL-6) and tumour necrosis factor-alpha (TNF-alpha). | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | human kidney cell line, 293T | NA | NA | NA | NA | It has the role in immuno inflammation. | Transfection and luciferase assay | 17433078 | 2007 | NA |
| PRRID_0260 | N-ALP1 Click for more detail | Mycoplasma pneumoniae (Bacteria) | NA | NA | Lipoprotein | Natural | It induces the activation of NF-kappaB and induces the expression levels of interleukin-6 (IL-6) and tumour necrosis factor-alpha (TNF-alpha). | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | human kidney cell line, 293T | NA | NA | NA | NA | It has the role in immuno inflammation. | Transfection and luciferase assay | 17433078 | 2007 | NA |
| PRRID_0261 | N-ALP2 Click for more detail | Mycoplasma pneumoniae (Bacteria) | NA | NA | Lipoprotein | Natural | It induces the activation of NF-kappaB and induces the expression levels of interleukin-6 (IL-6) and tumour necrosis factor-alpha (TNF-alpha). | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | human kidney cell line, 293T | NA | NA | NA | NA | It has the role in immuno inflammation. | Transfection and luciferase assay | 17433078 | 2007 | NA |
| PRRID_0261 | N-ALP2 Click for more detail | Mycoplasma pneumoniae (Bacteria) | NA | NA | Lipoprotein | Natural | It induces the activation of NF-kappaB and induces the expression levels of interleukin-6 (IL-6) and tumour necrosis factor-alpha (TNF-alpha). | Toll-like receptor 1/2 (TLR1/2) | Toll-like receptor (TLR) | Human | human kidney cell line, 293T | NA | NA | NA | NA | It has the role in immuno inflammation. | Transfection and luciferase assay | 17433078 | 2007 | NA |
| PRRID_0287 | FTT1103 Click for more detail | Mycoplasma pneumoniae (Bacteria) | NA | NA | Lipoprotein | Natural | Immunostimulant | Toll-like receptor 2 (TLR2)/Toll-like receptor (TLR1 | Toll-like receptor (TLR) | Human | NA | NA | NA | NA | NA | capable of stimulating a proinflammatory response and the cellular receptors they trigger | NA | 18079113 | 2008 | NA |
| PRRID_0287 | FTT1103 Click for more detail | Mycoplasma pneumoniae (Bacteria) | NA | NA | Lipoprotein | Natural | Immunostimulant | Toll-like receptor 2 (TLR2)/Toll-like receptor (TLR1 | Toll-like receptor (TLR) | Human | NA | NA | NA | NA | NA | capable of stimulating a proinflammatory response and the cellular receptors they trigger | NA | 18079113 | 2008 | NA |
| PRRID_0311 | Lipoprotein Click for more detail | Ureaplasma parvum (Bacteria) | NA | NA | Lipoprotein | Natural | Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF- | Toll-like receptor 1 (TLR1) | Toll-like receptor (TLR) | Human | Kidney cell line, 293T | LRR | Q15399.fasta | Q15399 | 786 | This induces the inflammatory response. | ELISA | 18451040 | 2008 | Pubchem Assay |
| PRRID_0311 | Lipoprotein Click for more detail | Ureaplasma parvum (Bacteria) | NA | NA | Lipoprotein | Natural | Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF- | Toll-like receptor 1 (TLR1) | Toll-like receptor (TLR) | Human | Kidney cell line, 293T | LRR | Q15399.fasta | Q15399 | 786 | This induces the inflammatory response. | ELISA | 18451040 | 2008 | Pubchem Assay |
| PRRID_0312 | Lipoprotein Click for more detail | Ureaplasma parvum (Bacteria) | NA | NA | Lipoprotein | Natural | Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF- | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Kidney cell line, 293T | LRR | O60603.fasta | O60603 | 784 | This induces the inflammatory response. | ELISA | 18451040 | 2008 | Pubchem Assay |
| PRRID_0312 | Lipoprotein Click for more detail | Ureaplasma parvum (Bacteria) | NA | NA | Lipoprotein | Natural | Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF- | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Kidney cell line, 293T | LRR | O60603.fasta | O60603 | 784 | This induces the inflammatory response. | ELISA | 18451040 | 2008 | Pubchem Assay |
| PRRID_0313 | Lipoprotein Click for more detail | Ureaplasma parvum (Bacteria) | NA | NA | Lipoprotein | Natural | Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF- | Toll-like receptor 6 (TLR6) | Toll-like receptor (TLR) | Human | Kidney cell line, 293T | LRR | Q9Y2C9.fasta | Q9Y2C9 | 796 | This induces the inflammatory response. | ELISA | 18451040 | 2008 | Pubchem Assay |
| PRRID_0313 | Lipoprotein Click for more detail | Ureaplasma parvum (Bacteria) | NA | NA | Lipoprotein | Natural | Upon ligand engagement TLR proteins trigger downstream cellular signaling, leads to the activation of NF- | Toll-like receptor 6 (TLR6) | Toll-like receptor (TLR) | Human | Kidney cell line, 293T | LRR | Q9Y2C9.fasta | Q9Y2C9 | 796 | This induces the inflammatory response. | ELISA | 18451040 | 2008 | Pubchem Assay |
| PRRID_0314 | Lipoprotein Click for more detail | Listeria monocytogenes (Bacteria) | NA | NA | Lipoprotein | Natural | It leads to the activation of NF-κB and stimulates the production of proinflammatory cytokines such as TNF-alpha and IL-6. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Bone marrow-derived DC | NA | Q9QUN7.fasta | Q9QUN7 | 784 | It has a immunostimulatory role | Cytokines assay | 18641340 | 2008 | Pubchem Assay |
| PRRID_0314 | Lipoprotein Click for more detail | Listeria monocytogenes (Bacteria) | NA | NA | Lipoprotein | Natural | It leads to the activation of NF-κB and stimulates the production of proinflammatory cytokines such as TNF-alpha and IL-6. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | Bone marrow-derived DC | NA | Q9QUN7.fasta | Q9QUN7 | 784 | It has a immunostimulatory role | Cytokines assay | 18641340 | 2008 | Pubchem Assay |
| PRRID_0327 | MG149 Click for more detail | Mycoplasma genitalium (Bacteria) | CCCCCCCC1=CC=C(C=C1)CCC2=C(C(=CC=C2)O)C(=O)O | NA | Lipoprotein | Natural | On binding to the TLR2, it induces the activation of NF- | Toll-like receptor (TLR1 and Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Kidney cell line, 293T | LRR | NA | NA | NA | It has a immunostimulatory role | ELISA | 18474641 | 2008 | NA |
| PRRID_0327 | MG149 Click for more detail | Mycoplasma genitalium (Bacteria) | CCCCCCCC1=CC=C(C=C1)CCC2=C(C(=CC=C2)O)C(=O)O | NA | Lipoprotein | Natural | On binding to the TLR2, it induces the activation of NF- | Toll-like receptor (TLR1 and Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | Kidney cell line, 293T | LRR | NA | NA | NA | It has a immunostimulatory role | ELISA | 18474641 | 2008 | NA |
| PRRID_0345 | SalP Click for more detail | Bacteria | NA | NA | Lipoprotein | Natural | Immunostimulant | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | human corneal epithelial | NA | O60603.fasta | O60603 | 784 | NA | Western Blot analysis | 18191935 | 2008 | Pubchem Assay |
| PRRID_0345 | SalP Click for more detail | Bacteria | NA | NA | Lipoprotein | Natural | Immunostimulant | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | human corneal epithelial | NA | O60603.fasta | O60603 | 784 | NA | Western Blot analysis | 18191935 | 2008 | Pubchem Assay |
| PRRID_0351 | TUL4 Click for more detail | Mycoplasma pneumoniae (Bacteria) | NA | NA | Lipoprotein | Natural | Immunostimulant | Toll-like receptor 2 (TLR2)/Toll-like receptor (TLR1 | Toll-like receptor (TLR) | Human | NA | NA | NA | NA | NA | capable of stimulating a proinflammatory response and the cellular receptors they trigger | NA | 18079113 | 2008 | NA |
| PRRID_0351 | TUL4 Click for more detail | Mycoplasma pneumoniae (Bacteria) | NA | NA | Lipoprotein | Natural | Immunostimulant | Toll-like receptor 2 (TLR2)/Toll-like receptor (TLR1 | Toll-like receptor (TLR) | Human | NA | NA | NA | NA | NA | capable of stimulating a proinflammatory response and the cellular receptors they trigger | NA | 18079113 | 2008 | NA |
| PRRID_0370 | Lipoprotein Click for more detail | S. gordonii (Bacteria) | NA | NA | Lipoprotein | Natural | Stimulation elicits the production of tumour necrosis factor (TNF) and interleukin (IL)-6. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | Bone-marrow derived Dendritic cells | LRR | Q9QUN7.fasta | Q9QUN7 | 784 | This activation can be attributed to multiple immunostimulatory components present within S. gordonii bacterial cells. | ELISA | 19284500 | 2009 | Pubchem Assay |
| PRRID_0370 | Lipoprotein Click for more detail | S. gordonii (Bacteria) | NA | NA | Lipoprotein | Natural | Stimulation elicits the production of tumour necrosis factor (TNF) and interleukin (IL)-6. | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | Bone-marrow derived Dendritic cells | LRR | Q9QUN7.fasta | Q9QUN7 | 784 | This activation can be attributed to multiple immunostimulatory components present within S. gordonii bacterial cells. | ELISA | 19284500 | 2009 | Pubchem Assay |
| PRRID_0407 | acylated LprA Click for more detail | M. tuberculosis (Bacteria) | NA | NA | Lipoprotein | Natural | Induced IL-8 secretion | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | Phagocytosis | ELISA | 20694006 | 2010 | Pubchem Assay |
| PRRID_0407 | acylated LprA Click for more detail | M. tuberculosis (Bacteria) | NA | NA | Lipoprotein | Natural | Induced IL-8 secretion | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | Phagocytosis | ELISA | 20694006 | 2010 | Pubchem Assay |
| PRRID_0408 | acylated LprG Click for more detail | M. tuberculosis (Bacteria) | NA | NA | Lipoprotein | Natural | Delivery of glycolipds to TLR2 | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | Phagocytosis | ELISA | 20694006 | 2010 | Pubchem Assay |
| PRRID_0408 | acylated LprG Click for more detail | M. tuberculosis (Bacteria) | NA | NA | Lipoprotein | Natural | Delivery of glycolipds to TLR2 | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Human | NA | Leucine-rich Repeat (LRR) Domain | O60603.fasta | O60603 | 784 | Phagocytosis | ELISA | 20694006 | 2010 | Pubchem Assay |
| PRRID_0458 | cy2-labeled SitC-His Click for more detail | S. aureus (Bacteria) | NA | NA | Lipoprotein | Natural | It induce release of IL-6 in primary murine keratinocytes | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | Keratinocytes | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It induce intracellular accumulation of TLR2 | NA | 20679445 | 2010 | Pubchem Assay |
| PRRID_0458 | cy2-labeled SitC-His Click for more detail | S. aureus (Bacteria) | NA | NA | Lipoprotein | Natural | It induce release of IL-6 in primary murine keratinocytes | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice (Murine) | Keratinocytes | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | It induce intracellular accumulation of TLR2 | NA | 20679445 | 2010 | Pubchem Assay |
| PRRID_0462 | Diacylated Lipopeptide Click for more detail | M. tuberculosis (Bacteria) | NA | NA | Lipoprotein | Natural | On binding to the receptor it, activates the heterocomplex of TLR2/1 and secretion of cytokines takes place | Toll-like receptor 2/6 (TLR2/6) | Toll-like receptor (TLR) | DNA samples from peripheral blood of TB patients | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | Immunostimulation and inflammation | NA | 20797905 | 2010 | NA |
| PRRID_0462 | Diacylated Lipopeptide Click for more detail | M. tuberculosis (Bacteria) | NA | NA | Lipoprotein | Natural | On binding to the receptor it, activates the heterocomplex of TLR2/1 and secretion of cytokines takes place | Toll-like receptor 2/6 (TLR2/6) | Toll-like receptor (TLR) | DNA samples from peripheral blood of TB patients | NA | Leucine-rich Repeat (LRR) Domain | NA | NA | NA | Immunostimulation and inflammation | NA | 20797905 | 2010 | NA |
| PRRID_0525 | FSL-1 Click for more detail | Mycoplasma (Bacteria) | CCCCCCCCCCCCCCCC(=O)OCC(CSC[C@@H](C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC2=CN=CN2)C(=O)N3CCC[C@H]3C(=O)N[C@@H](CCCCN)C(=ON[C@@H(COC(=O)N[C@@H](CC4=CC=CC=C4)C(=O)O)N)OC(=O)CCCCCCCCCCCCCCC | NA | Lipoprotein | Synthetic | FSL-1 binds to the heterocomplex of TLR2 and TLR6 and activates the downstream signalling | Toll-like receptor 2/6 (TLR2/6) | Toll-like receptor (TLR) | Human | Keratinocytes | Leucine-rich Repeat (LRR) Domain | Q9BXR5.fasta | Q9BXR5 | 811 | It has the role in the inflammation. | NA | 20728939 | 2010 | Pubchem Assay |
| PRRID_0525 | FSL-1 Click for more detail | Mycoplasma (Bacteria) | CCCCCCCCCCCCCCCC(=O)OCC(CSC[C@@H](C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC2=CN=CN2)C(=O)N3CCC[C@H]3C(=O)N[C@@H](CCCCN)C(=ON[C@@H(COC(=O)N[C@@H](CC4=CC=CC=C4)C(=O)O)N)OC(=O)CCCCCCCCCCCCCCC | NA | Lipoprotein | Synthetic | FSL-1 binds to the heterocomplex of TLR2 and TLR6 and activates the downstream signalling | Toll-like receptor 2/6 (TLR2/6) | Toll-like receptor (TLR) | Human | Keratinocytes | Leucine-rich Repeat (LRR) Domain | Q9BXR5.fasta | Q9BXR5 | 811 | It has the role in the inflammation. | NA | 20728939 | 2010 | Pubchem Assay |
| PRRID_0526 | FSL-1 Click for more detail | Mycoplasma salivarium (Bacteria) | CCCCCCCCCCCCCCCC(=O)OCC(CSC[C@@H](C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC2=CN=CN2)C(=O)N3CCC[C@H]3C(=O)N[C@@H](CCCCN)C(=ON[C@@H(COC(=O)N[C@@H](CC4=CC=CC=C4)C(=O)O)N)OC(=O)CCCCCCCCCCCCCCC | NA | Lipoprotein | Synthetic | Binding of the ligand leads to Akt phosphorylation and activation of the transcription factor NF-κB which results in secretion of proinflammatory cytokines | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | embryonic mouse telencephalon and NPC | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | its activation inhibits NPC proliferation and decreases cell proliferation. | NA | 20456021 | 2010 | Pubchem Assay |
| PRRID_0526 | FSL-1 Click for more detail | Mycoplasma salivarium (Bacteria) | CCCCCCCCCCCCCCCC(=O)OCC(CSC[C@@H](C(=O)NCC(=O)N[C@@H](CC(=O)O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC2=CN=CN2)C(=O)N3CCC[C@H]3C(=O)N[C@@H](CCCCN)C(=ON[C@@H(COC(=O)N[C@@H](CC4=CC=CC=C4)C(=O)O)N)OC(=O)CCCCCCCCCCCCCCC | NA | Lipoprotein | Synthetic | Binding of the ligand leads to Akt phosphorylation and activation of the transcription factor NF-κB which results in secretion of proinflammatory cytokines | Toll-like receptor 2 (TLR2) | Toll-like receptor (TLR) | Mice | embryonic mouse telencephalon and NPC | Leucine-rich Repeat (LRR) Domain | Q9QUN7.fasta | Q9QUN7 | 784 | its activation inhibits NPC proliferation and decreases cell proliferation. | NA | 20456021 | 2010 | Pubchem Assay |