Browse result page of PRRDB 2.0

PRRID	Name of Ligand	Source of ligand	Sequence of Ligand	Length of Ligand	Type of Ligand	Occurence	Role of Ligand	Name of Receptor	Type of Reeptor	Source of the Receptor	Localization	Domain	Sequence of Receptor	Swiss prot ID	Length of receptor	Function of Receptor	Assay used	PMID	Year of publication	Pubchem assay
PRRID_1371	Imiquimod Click for more detail	Virus	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	immune modulators	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	mast cells	Cell Compartment/Intracellular (Endosome)	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	Real-time PCR	24818634	2014	Pubchem_assay
PRRID_1371	Imiquimod Click for more detail	Virus	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	immune modulators	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	mast cells	Cell Compartment/Intracellular (Endosome)	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	Real-time PCR	24818634	2014	Pubchem_assay
PRRID_1373	Imiquimod Click for more detail	NA	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	Amine analog to guanosine, is an immune response modifier with potent indirect antiviral activity.	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	Spleen cells	cell compartment	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	whole blood assay (WBA), ELISA	24766820	2014	Pubchem_assay
PRRID_1373	Imiquimod Click for more detail	NA	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	Amine analog to guanosine, is an immune response modifier with potent indirect antiviral activity.	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	Spleen cells	cell compartment	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	whole blood assay (WBA), ELISA	24766820	2014	Pubchem_assay
PRRID_1374	Imiquimod Click for more detail	NA	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	activates anti-tumor immunity	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	skin samples	NA	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	MTT assay	24743316	2014	Pubchem_assay
PRRID_1374	Imiquimod Click for more detail	NA	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	activates anti-tumor immunity	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	skin samples	NA	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	MTT assay	24743316	2014	Pubchem_assay
PRRID_1375	Imiquimod Click for more detail	imidazoquinoline amine analogue to guanosine (others)	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	induced significant up-regulation of IL-1b, IL-6, IL-8, IL-10, IFN-c, IFN-a1 and Mx	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	NA	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	Real-time PCR	24736205	2014	Pubchem_assay
PRRID_1375	Imiquimod Click for more detail	imidazoquinoline amine analogue to guanosine (others)	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	induced significant up-regulation of IL-1b, IL-6, IL-8, IL-10, IFN-c, IFN-a1 and Mx	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	NA	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	Real-time PCR	24736205	2014	Pubchem_assay
PRRID_1376	Imiquimod (R837) Click for more detail	Virus	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Nucleic Acid	Synthetic	Amine analog to guanosine, is an immune response modifier with potent indirect antiviral activity.	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	nasal mucosa Mesenchymal stromal cells (nmMSCs) inferior nasal concha of healthy individuals	endosomal receptor	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	ELISA and Immunofluoroscence assay	24830384	2014	Pubchem_assay
PRRID_1376	Imiquimod (R837) Click for more detail	Virus	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Nucleic Acid	Synthetic	Amine analog to guanosine, is an immune response modifier with potent indirect antiviral activity.	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	nasal mucosa Mesenchymal stromal cells (nmMSCs) inferior nasal concha of healthy individuals	endosomal receptor	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	ELISA and Immunofluoroscence assay	24830384	2014	Pubchem_assay
PRRID_1377	Imiquimod (R837) Click for more detail	Virus	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Nucleic Acid	Synthetic	immune modulators	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	plasmacytoid and myeloid DCs	Cell Compartment/Intracellular (Endosome)	Q9NYK1.fasta	Q9NYK1	1049	TLR7-mediated activation of these cells resulted in the induction of the pro-inflammatory cytokines IFN-Œ±, IFN-Œ≤, TNF-Œ±, and IL-12	ELISA	24825342	2014	Pubchem_assay
PRRID_1377	Imiquimod (R837) Click for more detail	Virus	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Nucleic Acid	Synthetic	immune modulators	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	plasmacytoid and myeloid DCs	Cell Compartment/Intracellular (Endosome)	Q9NYK1.fasta	Q9NYK1	1049	TLR7-mediated activation of these cells resulted in the induction of the pro-inflammatory cytokines IFN-Œ±, IFN-Œ≤, TNF-Œ±, and IL-12	ELISA	24825342	2014	Pubchem_assay
PRRID_1378	Imiquimod (R837) Click for more detail	Virus	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Nucleic Acid	Synthetic	treatment of genital warts and malignant tumors of the skin and also act as immune modulator	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	plasmacytoid and myeloid DCs	extracellular domain (ECD)	Q9NYK1.fasta	Q9NYK1	1049	human plasmacytoid dendritic cells (pDC) TLR7 signaling induces cell maturation, differentiation and type I IFN production via IRF5 and 7.	Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot	24813206	2014	Pubchem_assay
PRRID_1378	Imiquimod (R837) Click for more detail	Virus	CC(C)CN1C=NC2=C1C3=CC=CC=C3N=C2N	NA	Nucleic Acid	Synthetic	treatment of genital warts and malignant tumors of the skin and also act as immune modulator	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	plasmacytoid and myeloid DCs	extracellular domain (ECD)	Q9NYK1.fasta	Q9NYK1	1049	human plasmacytoid dendritic cells (pDC) TLR7 signaling induces cell maturation, differentiation and type I IFN production via IRF5 and 7.	Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot	24813206	2014	Pubchem_assay
PRRID_1380	IMO-2055 Click for more detail	NA	NA	NA	Nucleic Acid	Synthetic	it enhances the efficacy of antitumor agents through immune stimulation	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human patients with advanced non-small cell lung cancer (nSClC)	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	cell compartment	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	NA	24770667	2014	Pubchem_assay
PRRID_1380	IMO-2055 Click for more detail	NA	NA	NA	Nucleic Acid	Synthetic	it enhances the efficacy of antitumor agents through immune stimulation	Toll-like receptor 9 (TLR9)	Toll-like receptor (TLR)	Human patients with advanced non-small cell lung cancer (nSClC)	monocyte/macrophages, plasmacytoid DCs and B-lymphocytes	cell compartment	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	NA	24770667	2014	Pubchem_assay
PRRID_1382	internalized flagellin Click for more detail	Salmonella typhimurium or Legionella pneumophila (Bacteria)	KLSFEDKNGKVIDGGYAVKMGDDFYAATYDEKTGAITAKTTTYTDGTGVAQTGAVKFGGANGKSEVVTATDGKTYL	76	Protein	Natural	Flagellin and LPS stimulate the production of CXCL1 and CXCL2	Nod-like receptor C4 (NLRC4)	NOD-like receptor (NLR)	Human	medullary collecting duct (MCD) cells	intracellular receptors	Q9NPP4.fasta	Q9NPP4	1024	assemble in an inflammasome complex to activate caspase-1 and promote the release of IL-1Œ≤ and IL-18	ELISA, adhesion and invasion assay	24779433	2014	Pubchem_assay
PRRID_1382	internalized flagellin Click for more detail	Salmonella typhimurium or Legionella pneumophila (Bacteria)	KLSFEDKNGKVIDGGYAVKMGDDFYAATYDEKTGAITAKTTTYTDGTGVAQTGAVKFGGANGKSEVVTATDGKTYL	76	Protein	Natural	Flagellin and LPS stimulate the production of CXCL1 and CXCL2	Nod-like receptor C4 (NLRC4)	NOD-like receptor (NLR)	Human	medullary collecting duct (MCD) cells	intracellular receptors	Q9NPP4.fasta	Q9NPP4	1024	assemble in an inflammasome complex to activate caspase-1 and promote the release of IL-1Œ≤ and IL-18	ELISA, adhesion and invasion assay	24779433	2014	Pubchem_assay
PRRID_1387	L-ornithine muramyl tripeptide Click for more detail	Gram-positive bacteria and some Gram-negative spirochaetes.	CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCNC(=O)[C@H](C)NC(=O)CC[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(=O)C)C=O)C(=O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Peptide	Natural	in vitro activates Nod	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut	intracellular receptors	Q9HC29.fasta	Q9HC29	1040	Nod2, are associ- ated with inflammatory bowel disease in humans	NA	24779390	2014	Pubchem_assay
PRRID_1387	L-ornithine muramyl tripeptide Click for more detail	Gram-positive bacteria and some Gram-negative spirochaetes.	CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)OCCNC(=O)[C@H](C)NC(=O)CC[C@@H](NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@@H]([C@H](O)[C@H](O)CO)[C@@H](NC(=O)C)C=O)C(=O)N)OC(=O)CCCCCCCCCCCCCCC	NA	Peptide	Natural	in vitro activates Nod	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	immune cells like peripheral blood monocytes, granulocytes and dendritic cells, as well as in astrocytes of the brain and in paneth cells of the gut	intracellular receptors	Q9HC29.fasta	Q9HC29	1040	Nod2, are associ- ated with inflammatory bowel disease in humans	NA	24779390	2014	Pubchem_assay
PRRID_1390	lipo-arabinomannan Click for more detail	Mycobacteria (Bacteria)	CCC(CO)NCCNC(CC)CO	NA	Glycolipid	Natural	serve as a modulin with immunoregulatory and anti-inflammatory effects.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domain with leucine-rich repeats and a conservative intracellular Toll/IL- 1 receptor (TIR) domain	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	ELISA	24757287	2014	Pubchem_assay
PRRID_1390	lipo-arabinomannan Click for more detail	Mycobacteria (Bacteria)	CCC(CO)NCCNC(CC)CO	NA	Glycolipid	Natural	serve as a modulin with immunoregulatory and anti-inflammatory effects.	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domain with leucine-rich repeats and a conservative intracellular Toll/IL- 1 receptor (TIR) domain	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	ELISA	24757287	2014	Pubchem_assay
PRRID_1393	Lipopeptides Click for more detail	Bacteria	NA	NA	Fatty acid	Natural	elicit innate immune response	Toll-like receptor 1 (TLR1)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs and B-lymphocytes	Cell surface	Q15399.fasta	Q15399	786	NA	NA	24807166	2014	Pubchem_assay
PRRID_1393	Lipopeptides Click for more detail	Bacteria	NA	NA	Fatty acid	Natural	elicit innate immune response	Toll-like receptor 1 (TLR1)	Toll-like receptor (TLR)	Human	monocyte/macrophages, DCs and B-lymphocytes	Cell surface	Q15399.fasta	Q15399	786	NA	NA	24807166	2014	Pubchem_assay
PRRID_1395	Lipopeptides Click for more detail	Bacteria	NA	NA	Fatty acid	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domains of leucine-rich repeat motifs	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	Pubchem_assay
PRRID_1395	Lipopeptides Click for more detail	Bacteria	NA	NA	Fatty acid	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domains of leucine-rich repeat motifs	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	Pubchem_assay
PRRID_1396	Lipopolysaccharide (LPS) Click for more detail	Gram-negative bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	induces a strong response from normal animal immune systems	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	nasal mucosa Mesenchymal stromal cells (nmMSCs) inferior nasal concha of healthy individuals	cell surface	O00206.fasta	O00206	839	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	ELISA and Immunofluoroscence assay	24830384	2014	Pubchem_assay
PRRID_1396	Lipopolysaccharide (LPS) Click for more detail	Gram-negative bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	induces a strong response from normal animal immune systems	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	nasal mucosa Mesenchymal stromal cells (nmMSCs) inferior nasal concha of healthy individuals	cell surface	O00206.fasta	O00206	839	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	ELISA and Immunofluoroscence assay	24830384	2014	Pubchem_assay
PRRID_1400	Lipopolysaccharide (LPS) Click for more detail	Gram-negative bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	induces a strong response from normal animal immune systems	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	mast cells	cell surface	O00206.fasta	O00206	839	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	Real-time PCR	24818634	2014	Pubchem_assay
PRRID_1400	Lipopolysaccharide (LPS) Click for more detail	Gram-negative bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	induces a strong response from normal animal immune systems	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	mast cells	cell surface	O00206.fasta	O00206	839	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	Real-time PCR	24818634	2014	Pubchem_assay
PRRID_1401	Lipopolysaccharide (LPS) Click for more detail	Gram-negative bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	induces a strong response from normal animal immune systems	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	cell surface	O00206.fasta	O00206	839	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	ELISA	24818579	2014	Pubchem_assay
PRRID_1401	Lipopolysaccharide (LPS) Click for more detail	Gram-negative bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	induces a strong response from normal animal immune systems	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	cell surface	O00206.fasta	O00206	839	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	ELISA	24818579	2014	Pubchem_assay
PRRID_1404	Lipopolysaccharide (LPS) Click for more detail	Gram-negative bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	induces a strong response from normal animal immune systems	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human Platelets	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	Leucine-rich Repeat (LRR) Domain	O00206.fasta	O00206	839	TLR4 is expressed on platelets which mediates inflammatory and immune responses in a variety of diseases including PAH (pulmonary arterial hypertension)	NA	24812346	2014	Pubchem_assay
PRRID_1404	Lipopolysaccharide (LPS) Click for more detail	Gram-negative bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	induces a strong response from normal animal immune systems	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human Platelets	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	Leucine-rich Repeat (LRR) Domain	O00206.fasta	O00206	839	TLR4 is expressed on platelets which mediates inflammatory and immune responses in a variety of diseases including PAH (pulmonary arterial hypertension)	NA	24812346	2014	Pubchem_assay
PRRID_1406	Lipopolysaccharide (LPS) Click for more detail	outer cell wall component of gram- negative bacteria (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	responsible for an endotoxin shock	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	cell surface	O00206.fasta	O00206	839	Possible effect in case of stroke i.e it is Involved in preconditioning, Up-regulation of TLR4 mRNA correlates with the severity of ischemia, TLR4-deficient animals have better outcome following cerebral ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1406	Lipopolysaccharide (LPS) Click for more detail	outer cell wall component of gram- negative bacteria (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	responsible for an endotoxin shock	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	cell surface	O00206.fasta	O00206	839	Possible effect in case of stroke i.e it is Involved in preconditioning, Up-regulation of TLR4 mRNA correlates with the severity of ischemia, TLR4-deficient animals have better outcome following cerebral ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1411	Lipopolysaccharide (LPS) Click for more detail	Gram negative Bacteria (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	elicit innate immune response	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Keratinocytes and mouse skin	cell surface	O00206.fasta	O00206	839	play a role in UVB induced immune suppression	NA	24786223	2014	Pubchem_assay
PRRID_1411	Lipopolysaccharide (LPS) Click for more detail	Gram negative Bacteria (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	elicit innate immune response	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Keratinocytes and mouse skin	cell surface	O00206.fasta	O00206	839	play a role in UVB induced immune suppression	NA	24786223	2014	Pubchem_assay
PRRID_1413	Lipopolysaccharide (LPS) Click for more detail	Gram negative Bacteria (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	triggers immune responses	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	ischemic brain tissue	cell surface	O00206.fasta	O00206	839	TLR4 signaling has been implicated in post-stroke neuroinflammation and injury and is also critical in the robustly neuroprotective ischemic preconditioning phenomenon	NA	24784586	2014	Pubchem_assay
PRRID_1413	Lipopolysaccharide (LPS) Click for more detail	Gram negative Bacteria (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	triggers immune responses	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	ischemic brain tissue	cell surface	O00206.fasta	O00206	839	TLR4 signaling has been implicated in post-stroke neuroinflammation and injury and is also critical in the robustly neuroprotective ischemic preconditioning phenomenon	NA	24784586	2014	Pubchem_assay
PRRID_1415	Lipopolysaccharide (LPS) Click for more detail	Gram-negative bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	triggers immune responses	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	human MSCs (hMSCs) and murine MSCs (mMSCs)	cell surface	O00206.fasta	O00206	839	the agonists of TLR3 and TLR4 in human MSCs (hMSCs) induce down- regulation of the of Notch ligand Jagged-1, and thus decrease the ability of MSCs to suppress allogeneic T cell proliferation	NA	24780395	2014	Pubchem_assay
PRRID_1415	Lipopolysaccharide (LPS) Click for more detail	Gram-negative bacteria	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	triggers immune responses	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	human MSCs (hMSCs) and murine MSCs (mMSCs)	cell surface	O00206.fasta	O00206	839	the agonists of TLR3 and TLR4 in human MSCs (hMSCs) induce down- regulation of the of Notch ligand Jagged-1, and thus decrease the ability of MSCs to suppress allogeneic T cell proliferation	NA	24780395	2014	Pubchem_assay
PRRID_1417	Lipopolysaccharide (LPS) Click for more detail	Gram negative Bacteria (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	Flagellin and LPS stimulate the production of CXCL1 and CXCL2	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	murine bladder epithelial cells and renal tubule cells	cell surface	O00206.fasta	O00206	839	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	ELISA, adhesion and invasion assay	24779433	2014	Pubchem_assay
PRRID_1417	Lipopolysaccharide (LPS) Click for more detail	Gram negative Bacteria (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	Flagellin and LPS stimulate the production of CXCL1 and CXCL2	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	murine bladder epithelial cells and renal tubule cells	cell surface	O00206.fasta	O00206	839	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	ELISA, adhesion and invasion assay	24779433	2014	Pubchem_assay
PRRID_1420	Lipopolysaccharide (LPS) Click for more detail	Gram negative Bacteria (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	triggers immune responses	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	gingival epithelial cells	cell surface	O00206.fasta	O00206	839	produce pro-inflammatory cytokines such as IL-8	ELISA	24773607	2014	Pubchem_assay
PRRID_1420	Lipopolysaccharide (LPS) Click for more detail	Gram negative Bacteria (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	triggers immune responses	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	gingival epithelial cells	cell surface	O00206.fasta	O00206	839	produce pro-inflammatory cytokines such as IL-8	ELISA	24773607	2014	Pubchem_assay
PRRID_1422	Lipopolysaccharide (LPS) Click for more detail	E. coli O26:B6(Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	triggers immune responses	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Macrophages	cell surface	O00206.fasta	O00206	839	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	ELISA	24771854	2014	Pubchem_assay
PRRID_1422	Lipopolysaccharide (LPS) Click for more detail	E. coli O26:B6(Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	triggers immune responses	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Macrophages	cell surface	O00206.fasta	O00206	839	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	ELISA	24771854	2014	Pubchem_assay
PRRID_1424	Lipopolysaccharide (LPS) Click for more detail	Gram negative Bacteria (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	it plays a dominant role in the induction of sepsis and hence is referred to as endotoxin	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	monocyte/macrophages	MyD88, TIRAP, TRIF and TRAM are the best characterized TIR domain-containing proteins that serve as adaptors in TLR signaling.	O00206.fasta	O00206	839	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	NA	24766885	2014	Pubchem_assay
PRRID_1424	Lipopolysaccharide (LPS) Click for more detail	Gram negative Bacteria (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	it plays a dominant role in the induction of sepsis and hence is referred to as endotoxin	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	monocyte/macrophages	MyD88, TIRAP, TRIF and TRAM are the best characterized TIR domain-containing proteins that serve as adaptors in TLR signaling.	O00206.fasta	O00206	839	TLR 4 leads to an intracellular signaling pathway NF-Œ∫B and inflammatory cytokine production which is responsible for activating the innate immune system	NA	24766885	2014	Pubchem_assay
PRRID_1426	Lipopolysaccharide (LPS) Click for more detail	Gram negative Bacteria (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	triggers immune responses	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Macrophages	cell surface	O00206.fasta	O00206	839	plays a fundamental role in pathogen recognition and activation of innate immunity	whole blood assay (WBA), ELISA	24766820	2014	Pubchem_assay
PRRID_1426	Lipopolysaccharide (LPS) Click for more detail	Gram negative Bacteria (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	triggers immune responses	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	Macrophages	cell surface	O00206.fasta	O00206	839	plays a fundamental role in pathogen recognition and activation of innate immunity	whole blood assay (WBA), ELISA	24766820	2014	Pubchem_assay
PRRID_1428	Lipopolysaccharide (LPS) Click for more detail	Gram negative Bacteria (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	triggers immune responses	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	monocyte/macrophages	cell surface	O00206.fasta	O00206	839	plays a fundamental role in pathogen recognition and activation of innate immunity	T cell differentiation assay	24760154	2014	Pubchem_assay
PRRID_1428	Lipopolysaccharide (LPS) Click for more detail	Gram negative Bacteria (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	triggers immune responses	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	monocyte/macrophages	cell surface	O00206.fasta	O00206	839	plays a fundamental role in pathogen recognition and activation of innate immunity	T cell differentiation assay	24760154	2014	Pubchem_assay
PRRID_1430	Lipopolysaccharide (LPS) Click for more detail	Gram negative Bacteria (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	elicit innate immune response	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	signaling occurs through an adapter protein Toll/IL-1 receptor domain-containing adaptor inducing IFN-b (TRIF)	O00206.fasta	O00206	839	plays a fundamental role in pathogen recognition and activation of innate immunity	NA	24754320	2014	Pubchem_assay
PRRID_1430	Lipopolysaccharide (LPS) Click for more detail	Gram negative Bacteria (Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	elicit innate immune response	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	signaling occurs through an adapter protein Toll/IL-1 receptor domain-containing adaptor inducing IFN-b (TRIF)	O00206.fasta	O00206	839	plays a fundamental role in pathogen recognition and activation of innate immunity	NA	24754320	2014	Pubchem_assay
PRRID_1432	Lipopolysaccharide (LPS) Click for more detail	E. coli K12(Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	induced significant up-regulation of IL-1b and IL-8	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	NA	O00206.fasta	O00206	839	plays a fundamental role in¬†pathogen¬†recognition and activation of¬†innate immunity	Real-time PCR	24736205	2014	Pubchem_assay
PRRID_1432	Lipopolysaccharide (LPS) Click for more detail	E. coli K12(Bacteria)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Lipopolysaccharide (LPS)	Natural	induced significant up-regulation of IL-1b and IL-8	Toll-like receptor 4 (TLR4)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells, B-lymphocyte	NA	O00206.fasta	O00206	839	plays a fundamental role in¬†pathogen¬†recognition and activation of¬†innate immunity	Real-time PCR	24736205	2014	Pubchem_assay
PRRID_1437	Lipoprotein Click for more detail	Gram-positive bacteria	NA	NA	Fatty acid	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	cell surface	O60603.fasta	O60603	784	Possible effect in case of stroke i.e Up-regulation of TLR2 mRNA correlates with severity of ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1437	Lipoprotein Click for more detail	Gram-positive bacteria	NA	NA	Fatty acid	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	cell surface	O60603.fasta	O60603	784	Possible effect in case of stroke i.e Up-regulation of TLR2 mRNA correlates with severity of ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1438	Lipoteichoic Acid (LTA) Click for more detail	Gram-positive bacteria	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)/Toll-like receptor 6 (TLR6)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	Cell Surface (Exogenous)	NA	NA	NA	significant role in the pathogenesis of severe inflammatory responses	NA	24830024	2014	NA
PRRID_1438	Lipoteichoic Acid (LTA) Click for more detail	Gram-positive bacteria	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)/Toll-like receptor 6 (TLR6)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	Cell Surface (Exogenous)	NA	NA	NA	significant role in the pathogenesis of severe inflammatory responses	NA	24830024	2014	NA
PRRID_1443	Lipoteichoic Acid (LTA) Click for more detail	Gram-positive bacteria	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	cell surface	O60603.fasta	O60603	784	Possible effect in case of stroke i.e Up-regulation of TLR2 mRNA correlates with severity of ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1443	Lipoteichoic Acid (LTA) Click for more detail	Gram-positive bacteria	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	cell surface	O60603.fasta	O60603	784	Possible effect in case of stroke i.e Up-regulation of TLR2 mRNA correlates with severity of ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1445	Lipoteichoic Acid (LTA) Click for more detail	Gram-positive bacteria	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	elicit innate immune response	Toll-like receptor 6 (TLR6)	Toll-like receptor (TLR)	Human	monocyte/macrophages, mast cells and B-lymphocytes	cell surface	Q9Y2C9.fasta	Q9Y2C9	796	significant role in the pathogenesis of severe inflammatory responses	NA	24807166	2014	Pubchem_assay
PRRID_1445	Lipoteichoic Acid (LTA) Click for more detail	Gram-positive bacteria	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	elicit innate immune response	Toll-like receptor 6 (TLR6)	Toll-like receptor (TLR)	Human	monocyte/macrophages, mast cells and B-lymphocytes	cell surface	Q9Y2C9.fasta	Q9Y2C9	796	significant role in the pathogenesis of severe inflammatory responses	NA	24807166	2014	Pubchem_assay
PRRID_1448	Lipoteichoic Acid (LTA) Click for more detail	Staphylococcus epidermidis (Bacteria)	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	keratinocytes and mouse skin	cell surface	O60603.fasta	O60603	784	important for inflammation in the skin following injury	NA	24786223	2014	Pubchem_assay
PRRID_1448	Lipoteichoic Acid (LTA) Click for more detail	Staphylococcus epidermidis (Bacteria)	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	keratinocytes and mouse skin	cell surface	O60603.fasta	O60603	784	important for inflammation in the skin following injury	NA	24786223	2014	Pubchem_assay
PRRID_1450	Lipoteichoic Acid (LTA) Click for more detail	Bacteria	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	ischemic brain tissue	cell surface	O60603.fasta	O60603	784	important for inflammation in the skin following injury	NA	24784586	2014	Pubchem_assay
PRRID_1450	Lipoteichoic Acid (LTA) Click for more detail	Bacteria	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	ischemic brain tissue	cell surface	O60603.fasta	O60603	784	important for inflammation in the skin following injury	NA	24784586	2014	Pubchem_assay
PRRID_1452	Lipoteichoic Acid (LTA) Click for more detail	cell wall of Gram-positive bacteria(Bacteria)	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages	cell surface	O60603.fasta	O60603	784	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24771854	2014	Pubchem_assay
PRRID_1452	Lipoteichoic Acid (LTA) Click for more detail	cell wall of Gram-positive bacteria(Bacteria)	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages	cell surface	O60603.fasta	O60603	784	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24771854	2014	Pubchem_assay
PRRID_1454	Lipoteichoic Acid (LTA) Click for more detail	cell wall of Gram-positive bacteria(Bacteria)	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages	cell surface	O60603.fasta	O60603	784	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24771328	2014	Pubchem_assay
PRRID_1454	Lipoteichoic Acid (LTA) Click for more detail	cell wall of Gram-positive bacteria(Bacteria)	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages	cell surface	O60603.fasta	O60603	784	plays a fundamental role in pathogen recognition and activation of innate immunity	ELISA	24771328	2014	Pubchem_assay
PRRID_1456	Lipoteichoic Acid (LTA) Click for more detail	Bacteria	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domains of leucine-rich repeat motifs	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	Pubchem_assay
PRRID_1456	Lipoteichoic Acid (LTA) Click for more detail	Bacteria	C(C1C(C(C(C(O1)OCC(CO)O)OC2C(C(C(C(O2)COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(COP(=O)(O)OCC(CO)O)O)O)O)O)O)O)O)O)O	NA	Amphiphile	Natural	elicit innate immune response	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domains of leucine-rich repeat motifs	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	Pubchem_assay
PRRID_1458	low molecular weight molecules of the imidazoquinoline family Click for more detail	A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	induce type I IFN, antiviral and antitumor therapeutic molecules	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	plasmacytoid and myeloid DCs	extracellular domain (ECD)	Q9NYK1.fasta	Q9NYK1	1049	controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation	Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot	24813206	2014	Pubchem_assay
PRRID_1458	low molecular weight molecules of the imidazoquinoline family Click for more detail	A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	induce type I IFN, antiviral and antitumor therapeutic molecules	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	plasmacytoid and myeloid DCs	extracellular domain (ECD)	Q9NYK1.fasta	Q9NYK1	1049	controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation	Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot	24813206	2014	Pubchem_assay
PRRID_1459	low molecular weight molecules of the imidazoquinoline family Click for more detail	A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	induce type I IFN, antiviral and antitumor therapeutic molecules	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	plasmacytoid and myeloid DCs	extracellular domain (ECD)	Q9NR97.fasta	Q9NR97	1041	controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation	Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot	24813206	2014	Pubchem_assay
PRRID_1459	low molecular weight molecules of the imidazoquinoline family Click for more detail	A tricyclic aromatic heterocycle formed by fusion of an imidazole ring with the pyridine ring	CCOCC1=NC2=C(N1CC(C)(C)O)C3=CC=CC=C3N=C2N	NA	Pattern-associated molecular patterns (PAMPs)	Synthetic	induce type I IFN, antiviral and antitumor therapeutic molecules	Toll-like receptor 8 (TLR8)	Toll-like receptor (TLR)	Human	plasmacytoid and myeloid DCs	extracellular domain (ECD)	Q9NR97.fasta	Q9NR97	1041	controlling antiviral host defense or autoimmune diseases and TLR8 and respond to its activation with TNF production and/or degranulation	Microarray analysis, Quantitative PCR, Phosphoproteomic screen, Confocal cell imaging,RNA40 pull-down assay and Immunoblot	24813206	2014	Pubchem_assay
PRRID_1462	Loxoribine (7-allyl-7,8-dihydro-8-oxo-guanosine) Click for more detail	Guanosine (others)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Nucleic Acid	Synthetic	up-regulate B-cells lymphoma-2 (Bcl-2) and promote the survival of lung cancer cells	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	lung cancer cells	cell compartment	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	MTT assay, Cell Proliferation Assay	24782650	2014	Pubchem_assay
PRRID_1462	Loxoribine (7-allyl-7,8-dihydro-8-oxo-guanosine) Click for more detail	Guanosine (others)	CCCCCCCCCCCCCC(=O)OC(CCCCCCCCCCC)CC(=O)OC1C(C(OC(C1OP(=O)(O)O)CO)OCC2C(C(C(C(O2)OP(=O)(O)O)NC(=O)CC(CCCCCCCCCCC)O)OC(=O)CC(CCCCCCCCCCC)O)O)NC(=O)CC(CCCCCCCCCCC)OC(=O)CCCCCCCCCCC	NA	Nucleic Acid	Synthetic	up-regulate B-cells lymphoma-2 (Bcl-2) and promote the survival of lung cancer cells	Toll-like receptor 7 (TLR7)	Toll-like receptor (TLR)	Human	lung cancer cells	cell compartment	Q9NYK1.fasta	Q9NYK1	1049	important role in the immune response to viral infection	MTT assay, Cell Proliferation Assay	24782650	2014	Pubchem_assay
PRRID_1475	macrophage-activating lipopeptide-2 (MALP-2) Click for more detail	Mycoplasma fementans (Bacteria)	NA	NA	Lipopeptides	Natural	It primes macrophages for cytokines secretion	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domains of leucine-rich repeat motifs	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	Pubchem_assay
PRRID_1475	macrophage-activating lipopeptide-2 (MALP-2) Click for more detail	Mycoplasma fementans (Bacteria)	NA	NA	Lipopeptides	Natural	It primes macrophages for cytokines secretion	Toll-like receptor 2 (TLR2)	Toll-like receptor (TLR)	Human	monocyte/macrophages, Myeloid DCs, neutrophils, Mast cells	extracellular domains of leucine-rich repeat motifs	O60603.fasta	O60603	784	significant role in the pathogenesis of severe inflammatory responses	NA	24754320	2014	Pubchem_assay
PRRID_1477	MALP-2 (macrophage-activating lipopeptide 2) Click for more detail	Mycoplasma (Bacteria)	C1=CC=C2C(=C1)C(=CN2)CC(C(=O)O)NC(=O)CCC(C(=O)O)N	NA	Lipopeptides	Natural	It primes macrophages for cytokines secretion	Toll-like receptor 2 (TLR2)/Toll-like receptor 6 (TLR6)	Toll-like receptor (TLR)	Human	monocyte/macrophages	cell surface	NA	NA	NA	fundamental role in pathogen recognition and activation of innate immunity.	ELISA	24771854	2014	NA
PRRID_1477	MALP-2 (macrophage-activating lipopeptide 2) Click for more detail	Mycoplasma (Bacteria)	C1=CC=C2C(=C1)C(=CN2)CC(C(=O)O)NC(=O)CCC(C(=O)O)N	NA	Lipopeptides	Natural	It primes macrophages for cytokines secretion	Toll-like receptor 2 (TLR2)/Toll-like receptor 6 (TLR6)	Toll-like receptor (TLR)	Human	monocyte/macrophages	cell surface	NA	NA	NA	fundamental role in pathogen recognition and activation of innate immunity.	ELISA	24771854	2014	NA
PRRID_1483	meso-diaminopomelic acid (meso- DAP) Click for more detail	Gram-negative bacteria and several Gram-positive bacteria such as Listeria and Bacillus spp	C(CC(C(=O)O)N)CC(C(=O)O)N	NA	Peptide	Natural	in vitro activates Nod1	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	macrophages and mesothelial cells	serine/threonine RIP2 (RICK, CARDIAK) kinase	Q9Y239.fasta	Q9Y239	953	Nod1 ligation also leads to the activation of NF-jB and MAPKs in neutrophils	ELISA	24766550	2014	Pubchem_assay
PRRID_1483	meso-diaminopomelic acid (meso- DAP) Click for more detail	Gram-negative bacteria and several Gram-positive bacteria such as Listeria and Bacillus spp	C(CC(C(=O)O)N)CC(C(=O)O)N	NA	Peptide	Natural	in vitro activates Nod1	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	macrophages and mesothelial cells	serine/threonine RIP2 (RICK, CARDIAK) kinase	Q9Y239.fasta	Q9Y239	953	Nod1 ligation also leads to the activation of NF-jB and MAPKs in neutrophils	ELISA	24766550	2014	Pubchem_assay
PRRID_1485	meso-lanthionine tripeptide Click for more detail	PGN of the anaerobic bacterium Fusobacterium nucleatum (Bacteria)	NA	NA	Peptide	Natural	in vitro activates Nod	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	most adult tissues	intracellular receptors	Q9Y239.fasta	Q9Y239	953	play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response.	NA	24779390	2014	Pubchem_assay
PRRID_1485	meso-lanthionine tripeptide Click for more detail	PGN of the anaerobic bacterium Fusobacterium nucleatum (Bacteria)	NA	NA	Peptide	Natural	in vitro activates Nod	Nucleotide Binding Oligomerization Domain Containing 1 (Nod1)	NOD-like receptor (NLR)	Human	most adult tissues	intracellular receptors	Q9Y239.fasta	Q9Y239	953	play key roles in regulation of innate immune response. NLRs can cooperate with Toll-like receptors and regulate inflammatory and apoptotic response.	NA	24779390	2014	Pubchem_assay
PRRID_1486	Mgn1703 Click for more detail	NA	NA	NA	novel, synthetic, dumb- bell-shaped, covalently closed Dna molecule	Synthetic	immuno modulators	PGLYRP-2	Peptidoglycan Recognition Receptor (PGRPs)	Human patients with metastatic colorectal carcinoma (CRC)	plasmacytoid dendritic cells (pDC) and B cells	cell compartment	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	NA	24816725	2014	Pubchem_assay
PRRID_1486	Mgn1703 Click for more detail	NA	NA	NA	novel, synthetic, dumb- bell-shaped, covalently closed Dna molecule	Synthetic	immuno modulators	PGLYRP-2	Peptidoglycan Recognition Receptor (PGRPs)	Human patients with metastatic colorectal carcinoma (CRC)	plasmacytoid dendritic cells (pDC) and B cells	cell compartment	Q9NR96.fasta	Q9NR96	1032	TLR9 plays a crucial role in breaking tolerance and developing autoimmunity	NA	24816725	2014	Pubchem_assay
PRRID_1490	mRNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Dendritic Cell, B-lymphocyte	cell compartment	O15455.fasta	O15455	904	Possible effect in case of stroke i.e it is Involved in preconditioning and No protection after gene knockout following cerebral ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1490	mRNA Click for more detail	RNA virus (Virus)	NA	NA	Nucleic Acid	Natural	triggers immune responses	Toll-like receptor 3 (TLR3)	Toll-like receptor (TLR)	Human	Dendritic Cell, B-lymphocyte	cell compartment	O15455.fasta	O15455	904	Possible effect in case of stroke i.e it is Involved in preconditioning and No protection after gene knockout following cerebral ischemia	NA	24807166	2014	Pubchem_assay
PRRID_1491	muramyl dipeptide (MDP) Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	leads to cytokine activation, especially IL-1Œ± and IL-1Œ≤.	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	peripheral blood mononuclear cells such as macrophages, granulocytes, dendritic cells, and along the intestinal epithelial cells	intracellular receptors	Q9HC29.fasta	Q9HC29	1040	recognizes fragments of the bacterial cell wall.	Luciferase assay	24790089	2014	Pubchem_assay
PRRID_1491	muramyl dipeptide (MDP) Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	leads to cytokine activation, especially IL-1Œ± and IL-1Œ≤.	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	peripheral blood mononuclear cells such as macrophages, granulocytes, dendritic cells, and along the intestinal epithelial cells	intracellular receptors	Q9HC29.fasta	Q9HC29	1040	recognizes fragments of the bacterial cell wall.	Luciferase assay	24790089	2014	Pubchem_assay
PRRID_1492	muramyl dipeptide (MDP) Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptidoglycan	Natural	leads to cytokine activation, especially IL-1Œ± and IL-1Œ≤.	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	peripheral mononuclear cells and monocyte-derived dendritic cells (Mo-DCs) from CD pateints	intracellular receptors	Q9HC29.fasta	Q9HC29	1040	Innate immune responses mediated by NOD2, including production of pro-inflammatory cytokines and antimicrobial peptides, as well as induction of autophagy, are thought to have a central role in the pathogenesis of CD and these processes are impaired in patients homozygous for NOD2 mutations	ELISA	24781050	2014	Pubchem_assay
PRRID_1492	muramyl dipeptide (MDP) Click for more detail	Gram-positive and negative bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptidoglycan	Natural	leads to cytokine activation, especially IL-1Œ± and IL-1Œ≤.	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	peripheral mononuclear cells and monocyte-derived dendritic cells (Mo-DCs) from CD pateints	intracellular receptors	Q9HC29.fasta	Q9HC29	1040	Innate immune responses mediated by NOD2, including production of pro-inflammatory cytokines and antimicrobial peptides, as well as induction of autophagy, are thought to have a central role in the pathogenesis of CD and these processes are impaired in patients homozygous for NOD2 mutations	ELISA	24781050	2014	Pubchem_assay
PRRID_1494	muramyl dipeptide (MDP) Click for more detail	Gram-negative and Gram-positive bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	induces interleu- kin-8 (IL-8) production, CD62 ligand shedding, and CD11b up-regulation	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	Neutrophils	serine/threonine RIP2 (RICK, CARDIAK) kinase	Q8K3Z0.fasta	Q8K3Z0	1020	involved in neutrophil immune responses in response to bacterial infection.	ELISA	24766550	2014	Pubchem_assay
PRRID_1494	muramyl dipeptide (MDP) Click for more detail	Gram-negative and Gram-positive bacteria	CC(C(=O)NC(CCC(=O)O)C(=O)N)NC(=O)C(C)OC1C(C(OC(C1O)CO)O)NC(=O)C	NA	Peptide	Natural	induces interleu- kin-8 (IL-8) production, CD62 ligand shedding, and CD11b up-regulation	Nucleotide Binding Oligomerization Domain Containing 2 (Nod2)	NOD-like receptor (NLR)	Human	Neutrophils	serine/threonine RIP2 (RICK, CARDIAK) kinase	Q8K3Z0.fasta	Q8K3Z0	1020	involved in neutrophil immune responses in response to bacterial infection.	ELISA	24766550	2014	Pubchem_assay

previous 1 2...10 11 121314 15 16...43 44 next